SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10014221m|PACid:20203626 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10014221m|PACid:20203626
Domain Number 1 Region: 66-296
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-84
Family Inorganic pyrophosphatase 0.000000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10014221m|PACid:20203626
Sequence length 300
Sequence
MAATRVITAAAAATQTTSCFLAKRTFLLPAKKSCGGFGGLCFNKRALVLKSKRPFSCSAI
YNPQVKVKEEGQPESLDYRVFFLDGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKME
VATDEDFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPSQANSEVEGAFGDNDPVDVV
EIGETQRKIGEVLKIKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANRFGLGDKPANKDYALKIIHETNESWAKLVKRSVDAGDLSLF
Download sequence
Identical sequences V4LB47
Thhalv10014221m|PACid:20203626 XP_006399446.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]