SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10017558m|PACid:20179869 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10017558m|PACid:20179869
Domain Number 1 Region: 30-131
Classification Level Classification E-value
Superfamily Cupredoxins 2.68e-31
Family Plastocyanin/azurin-like 0.00015
Further Details:      
 
Domain Number 2 Region: 145-247
Classification Level Classification E-value
Superfamily Cupredoxins 2.16e-30
Family Plastocyanin/azurin-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10017558m|PACid:20179869
Sequence length 279
Sequence
MATTTTLRTLRFVFVMMMSFTVLMGHHCSAKIYKVGDSEGWTAKADTYYDWAQRNEFNVG
DSLLFEYDRNVNDVTQVSSALAYDSCDSSSPKAVYNTGNDTVTLKEPGYHYFISSNHAQC
VAGQKLEVLVVRYDPSRPRKIFPFGNTYKVGDSNEWSVPKENDLYYKWSEEKQFHVGDSL
LFYYDDEVNDILEVNSDLEFKSCDPSSPLAVHSSGQDLIRLTKPGIHYFITSKTGHCEDG
LKLRVVVRPLHRAIREKRKLSPLDRLIKWLQSFRPHPHH
Download sequence
Identical sequences V4M824
XP_006409739.1.70970 Thhalv10017558m|PACid:20179869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]