SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10028344m|PACid:20189834 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028344m|PACid:20189834
Domain Number 1 Region: 807-1204
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.63e-78
Family Reverse transcriptase 0.00076
Further Details:      
 
Domain Number 2 Region: 540-573
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000329
Family Retrovirus zinc finger-like domains 0.0033
Further Details:      
 
Weak hits

Sequence:  Thhalv10028344m|PACid:20189834
Domain Number - Region: 676-760
Classification Level Classification E-value
Superfamily Acid proteases 0.00101
Family Retroviral protease (retropepsin) 0.028
Further Details:      
 
Domain Number - Region: 1416-1495
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0981
Family Inorganic pyrophosphatase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028344m|PACid:20189834
Sequence length 1508
Sequence
MEQHLVPATETEQMIPLRFNGRLMAIPTYTTEQLVQPLKQYLPGVPINKFNAAGDPIYAF
SDETGHKFFDICDCDYCLMSSSDEEEKPRRRKKKSSQQILKERYESGDPEVGLLGEPTGK
EFEYYVLYSNGSTPPTPDNEDVRICYMFGSSSSQEPTFPTREFEEGNIRHSWKIRNPNES
ELRSLKAQLQSLQNQPKTQTPMPYDLFTPYHIYSPPAMTQTQPLPFSHDPSIFGSSSFLP
TRIKEQRPAKKKHPTVPKETLKISAPENTKTTSPEKGEAQFMKRTTEASNSTDSHSGFSF
DNVPPSKWRDKIYEMHAWLTEQLLNPGATLPTVIDKLISKFQGRLRQWWISLGDYRQLHI
RQSQSVDTVIGHIHNEFLGTWDHYTIQAREEYMSMRCCSFKRKDLEKHYERMSKRFYVLN
GIDDVNLKQAYLNSLPEPLGNETSQILSLKNMTLSQASLGEIYQISLAALEKLCNHQKFF
KQLQEKGKLLGRACDRPELSIKCKTKRCKCSTSYKQEKKSRNKWQKRYPKLSGGKKWKFF
RRKKQRGYTKSDRCYICKKKRHYAKQCPNKKKRDYLIGYLAQVEDIDDSDIESIFSLDDG
PTDDTVLAMGIEHDDEFSEESETEEEEDADDQFMLFDLYTLDSCKVEESKKADLAYLSQP
APNSKIYIFPTKYDKPIPVIAFFDTGVASSIIKPDILPSTHWDRCSVAFKAANGQIFHIS
LISKPIHIQLFLGYMVKSKVYGSDLPGKDFILGFDILYSLKRFYPMELLNPIKEEITKTS
CASSHSEFLTKCSSPLWQNSDFFISLPFKKNEDINPTKASHPGMKPDHYTLALEEVNLLQ
KEGLIEKTTSPWACEAFYVNQRAGQVREKLRLVINYQPLNHFLADDKFPLPKREVLFQRL
PQAQVFSKFDLKAGFWQLGIKQEDIPKTGFCIADRRFQWKVTPFGLKVAPSLFQKAMTKI
FEPILPNALVYIDDILLFSPEIDSHTRLLEKFHKIVQQYGIMLSEKKMAIRETEIDFLGM
HISKGQYHLQPHIATQLNEFPDDKLSFKQVQQFLGVVNYMAEFIHGLAKYRSILSTQLKK
DAPPWDERCTEVVKELKRISKTLPSLKIPFKGKRILQTDASDCYWDSEKHYHSTYKEILA
VKRGIEKFGFHLVGQHFLIEMDMSSFPKMIQFKQKILPQAQLLRWASWFSQWKFDVKHNI
GKDNFLPDFLSRTQRQISAVIPMICTLTPTEESLRDMIAKMPQGIQEKILETALVYQRCE
KLHGFLKLYVYRYGLDQGPLLQLPYHPVFPFLTTIDLNPTHYGKFLQEAYFLLWYLAELY
TIGVLIDKSRLLQYLAKCILTRRKEHYKLLYKWLTLFHDVTWWQENIRAQEGYKVLVTFN
IITKQEQQEDGVIIQREYKAHIQTSYNDDPFDGENFHIRTRNLAAINHIEESEIDPQLFC
PHTANWHNRDAYPHDFIDEIRQNLASFHDQYAWPQDDPDHPIYRVEGKKYTIKRYIPGPQ
NLHNEDSF
Download sequence
Identical sequences V4M518
Thhalv10028344m|PACid:20189834 XP_006405940.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]