SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10028951m|PACid:20197344 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10028951m|PACid:20197344
Domain Number 1 Region: 36-215
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.62e-69
Family Inorganic pyrophosphatase 0.00000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10028951m|PACid:20197344
Sequence length 220
Sequence
MSEEVKKNQSEKENQSEKLQRPTPRLNERILSSLSRRSVAAHPWHDLEIGPGAPVIFNVV
IEISKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPV
LPGCFLRARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDY
KKNENKEVAVNDFLPNGPAVEAIQYSMDLYAEYILHSLRR
Download sequence
Identical sequences V4L668
Thhalv10028951m|PACid:20197344 XP_006396349.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]