SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Thhalv10021405m|PACid:20182171 from Thellungiella halophila v173

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Thhalv10021405m|PACid:20182171
Domain Number 1 Region: 102-183
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000307
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 209-239
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000249
Family CCCH zinc finger 0.0018
Further Details:      
 
Domain Number 3 Region: 37-63
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Thhalv10021405m|PACid:20182171
Sequence length 244
Sequence
MDARKRGRPEAGSYNSNGGGFKKSKQEMESYSTGLGSKSKPCTKFFSTSGCPFGENCHFL
HYVPGGYNAVAQLTNMGPPMPQVSRNMQGPVGGGRFSGRGESGPGHVSSFGASATAKISV
DASLAGAIIGKGGVSSKQICRQTGAKLSIQDHERDPNLKNIELEGTFEQINEASAMVREL
IGRLNSAARKPPGGGGGIGSEGKPHPGSNFKTKICERFSKGNCTFGDRCHFAHGEAELRR
SGIA
Download sequence
Identical sequences E4MYD4 V4M8U6
Thhalv10021405m|PACid:20182171 XP_006407365.1.70970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]