SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|219870555|ref|YP_002474930.1| from Haemophilus parasuis SH0165

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|219870555|ref|YP_002474930.1|
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily CAC2185-like 6.02e-73
Family CAC2185-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|219870555|ref|YP_002474930.1|
Sequence length 167
Comment exopolysaccharide biosynthesis protein [Haemophilus parasuis SH0165]
Sequence
MLHDLGLRFNSPFVNLFLTPTDFIKYVKNIAHYQTQEITFPKEIQRKYPVGLLGDIHIYF
MHYHSEQEAVKKWQERTARMDLNHLFIMMAERDGCRDEDLLEFEQLPFKNKVVFTHKPYP
ELTSAVYIQGFEQQQKIGDLFEYCGLNRKRFYDQFDYVGWFNQHKQN
Download sequence
Identical sequences B8F3T0
557723.HAPS_0295 gi|219870555|ref|YP_002474930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]