SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|49478168|ref|YP_037426.1| from Bacillus thuringiensis serovar konkukian str. 97-27

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|49478168|ref|YP_037426.1|
Domain Number 1 Region: 133-177
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0000589
Family Surp module (SWAP domain) 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|49478168|ref|YP_037426.1|
Domain Number - Region: 85-186
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.0549
Family MAPEG domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|49478168|ref|YP_037426.1|
Sequence length 240
Comment hypothetical protein BT9727_3103 [Bacillus thuringiensis serovar konkukian str. 97-27]
Sequence
MKLVIPKQHGAWAMLVIPFLLSVILGKPTIYHIPLFIAWFFIYLATYPFLMYIKQKRKKE
YLHAAIVYFIIAFVFGMISLLYEWRILLFVAVMIPFFIVNMYYARQKNERALLNDISAII
VFCIGGLVSYYFSMKLIDKTALFIALISFLYFLGSTFYVKTMIREKNNPKYRFISWGYHI
VLTVIVFAINPLCSLIFIPSVIRAIILYGKKISIIKVGILEIVNSVYFLIITAIIMKYAI
Download sequence
Identical sequences A0A0U0EEX5 A0A1Y6ADT7 Q6HGA0
gi|49478168|ref|YP_037426.1| WP_000779966.1.20665 WP_000779966.1.34158 WP_000779966.1.43104 WP_000779966.1.45385 WP_000779966.1.66331 WP_000779966.1.94373 YP_037426.1.62562 281309.BT9727_3103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]