SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|206560879|ref|YP_002231644.1| from Burkholderia cenocepacia J2315

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|206560879|ref|YP_002231644.1|
Domain Number 1 Region: 54-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.41e-29
Family DsbC/DsbG C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|206560879|ref|YP_002231644.1|
Sequence length 263
Comment DsbA-thioredoxin family protein [Burkholderia cenocepacia J2315]
Sequence
MSSKQTTLPGRVQALRKRAGRLPRLHWMVAGILVAGLLGWLLYRTPGAPAPRTGPEAAQA
HPAGPPWRHGPADARFTLTLYADLECPFCKAYYPTLMAWIDAHPDASLRWHHLPLAMHDP
EASRLARMAECAGEAQGHEAFFGAIAWLYQNTRGDGQGLPADLTWPGLTTAIQACLDSDR
SAAIVRAQADEALRSGINATPTVRLEDSLTGGSLLLHGPIDGDALLSALDLVASDASRAP
GPTHAADAALSGDTRTPAITTIR
Download sequence
Identical sequences B4E787
WP_012492784.1.10003 WP_012492784.1.100706 WP_012492784.1.11355 WP_012492784.1.14088 WP_012492784.1.21852 WP_012492784.1.24798 WP_012492784.1.25261 WP_012492784.1.27910 WP_012492784.1.29408 WP_012492784.1.31157 WP_012492784.1.33877 WP_012492784.1.34650 WP_012492784.1.38687 WP_012492784.1.45869 WP_012492784.1.4927 WP_012492784.1.52705 WP_012492784.1.55547 WP_012492784.1.57568 WP_012492784.1.64618 WP_012492784.1.66306 WP_012492784.1.67642 WP_012492784.1.69134 WP_012492784.1.70783 WP_012492784.1.71688 WP_012492784.1.7270 WP_012492784.1.75651 WP_012492784.1.79353 WP_012492784.1.83528 WP_012492784.1.85579 WP_012492784.1.86231 WP_012492784.1.87780 WP_012492784.1.87798 WP_012492784.1.88782 WP_012492784.1.95357 WP_012492784.1.95626 WP_012492784.1.99008 216591.BCAL2522 gi|206560879|ref|YP_002231644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]