SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218694230|ref|YP_002401897.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218694230|ref|YP_002401897.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.67e-48
Family Lambda phage gpU-like 0.000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218694230|ref|YP_002401897.1|
Sequence length 131
Comment Minor tail protein U [Escherichia coli 55989]
Sequence
MKHTELRAAVLDALEKHDTGATLFDGRPAVFDEADFPAIAVYLTGAEYTGEELDSDTWQA
ELHIEVFLPAQVPDSELDSWMESRIYPVMSDVPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM
Download sequence
Identical sequences A0A023KGB6 A0A0E0Y3G7 A0A222QH14 A0A2H1BNB5 B6IAW6 B7LBC6 F4VBP4 S1EKM2
gi|209918844|ref|YP_002292928.1| gi|407468227|ref|YP_006785331.1| 409438.ECSE_1653 481805.EcolC_2100 585055.EC55989_0800 gi|407483039|ref|YP_006780188.1| gi|410483592|ref|YP_006771138.1| WP_000683129.1.10080 WP_000683129.1.100928 WP_000683129.1.100933 WP_000683129.1.101293 WP_000683129.1.101359 WP_000683129.1.101651 WP_000683129.1.101845 WP_000683129.1.10744 WP_000683129.1.11006 WP_000683129.1.112 WP_000683129.1.12344 WP_000683129.1.12680 WP_000683129.1.12914 WP_000683129.1.14199 WP_000683129.1.14292 WP_000683129.1.14299 WP_000683129.1.14508 WP_000683129.1.14536 WP_000683129.1.15177 WP_000683129.1.15771 WP_000683129.1.16014 WP_000683129.1.16387 WP_000683129.1.16798 WP_000683129.1.17084 WP_000683129.1.17119 WP_000683129.1.17172 WP_000683129.1.17984 WP_000683129.1.18226 WP_000683129.1.18316 WP_000683129.1.18806 WP_000683129.1.19147 WP_000683129.1.19313 WP_000683129.1.19778 WP_000683129.1.20157 WP_000683129.1.20159 WP_000683129.1.20264 WP_000683129.1.20958 WP_000683129.1.21945 WP_000683129.1.22501 WP_000683129.1.22599 WP_000683129.1.22783 WP_000683129.1.23092 WP_000683129.1.23393 WP_000683129.1.2456 WP_000683129.1.24575 WP_000683129.1.24641 WP_000683129.1.24693 WP_000683129.1.25272 WP_000683129.1.26191 WP_000683129.1.26270 WP_000683129.1.2642 WP_000683129.1.26480 WP_000683129.1.26613 WP_000683129.1.27060 WP_000683129.1.27560 WP_000683129.1.2782 WP_000683129.1.27856 WP_000683129.1.28683 WP_000683129.1.29013 WP_000683129.1.30428 WP_000683129.1.30452 WP_000683129.1.30866 WP_000683129.1.31353 WP_000683129.1.3193 WP_000683129.1.32494 WP_000683129.1.32558 WP_000683129.1.32875 WP_000683129.1.33341 WP_000683129.1.33545 WP_000683129.1.34032 WP_000683129.1.34273 WP_000683129.1.34456 WP_000683129.1.34966 WP_000683129.1.35114 WP_000683129.1.35360 WP_000683129.1.35465 WP_000683129.1.36042 WP_000683129.1.36393 WP_000683129.1.36426 WP_000683129.1.36812 WP_000683129.1.36925 WP_000683129.1.36975 WP_000683129.1.37485 WP_000683129.1.3822 WP_000683129.1.38300 WP_000683129.1.39690 WP_000683129.1.40391 WP_000683129.1.40509 WP_000683129.1.41147 WP_000683129.1.41718 WP_000683129.1.41752 WP_000683129.1.4242 WP_000683129.1.42756 WP_000683129.1.4290 WP_000683129.1.43137 WP_000683129.1.43177 WP_000683129.1.43389 WP_000683129.1.43473 WP_000683129.1.43769 WP_000683129.1.44029 WP_000683129.1.44100 WP_000683129.1.4449 WP_000683129.1.4473 WP_000683129.1.45025 WP_000683129.1.45718 WP_000683129.1.46097 WP_000683129.1.46616 WP_000683129.1.47050 WP_000683129.1.47401 WP_000683129.1.47425 WP_000683129.1.47654 WP_000683129.1.47770 WP_000683129.1.4796 WP_000683129.1.48421 WP_000683129.1.4857 WP_000683129.1.49124 WP_000683129.1.49774 WP_000683129.1.49954 WP_000683129.1.50179 WP_000683129.1.50418 WP_000683129.1.50452 WP_000683129.1.51109 WP_000683129.1.51430 WP_000683129.1.51757 WP_000683129.1.52062 WP_000683129.1.52691 WP_000683129.1.52780 WP_000683129.1.52846 WP_000683129.1.532 WP_000683129.1.53228 WP_000683129.1.5342 WP_000683129.1.54023 WP_000683129.1.54144 WP_000683129.1.5486 WP_000683129.1.54918 WP_000683129.1.55151 WP_000683129.1.55417 WP_000683129.1.5561 WP_000683129.1.55676 WP_000683129.1.55787 WP_000683129.1.55979 WP_000683129.1.56149 WP_000683129.1.56177 WP_000683129.1.56586 WP_000683129.1.56689 WP_000683129.1.56882 WP_000683129.1.57051 WP_000683129.1.58001 WP_000683129.1.58143 WP_000683129.1.58507 WP_000683129.1.58582 WP_000683129.1.59781 WP_000683129.1.59932 WP_000683129.1.60325 WP_000683129.1.60436 WP_000683129.1.60457 WP_000683129.1.60805 WP_000683129.1.61183 WP_000683129.1.61398 WP_000683129.1.62681 WP_000683129.1.62762 WP_000683129.1.62788 WP_000683129.1.63177 WP_000683129.1.63556 WP_000683129.1.64707 WP_000683129.1.654 WP_000683129.1.66290 WP_000683129.1.67026 WP_000683129.1.67383 WP_000683129.1.67452 WP_000683129.1.67467 WP_000683129.1.67788 WP_000683129.1.68292 WP_000683129.1.69144 WP_000683129.1.70149 WP_000683129.1.70803 WP_000683129.1.71221 WP_000683129.1.72090 WP_000683129.1.72337 WP_000683129.1.72388 WP_000683129.1.72522 WP_000683129.1.72652 WP_000683129.1.73251 WP_000683129.1.73908 WP_000683129.1.73996 WP_000683129.1.74735 WP_000683129.1.74811 WP_000683129.1.74895 WP_000683129.1.75050 WP_000683129.1.7516 WP_000683129.1.75270 WP_000683129.1.75529 WP_000683129.1.7617 WP_000683129.1.76390 WP_000683129.1.76656 WP_000683129.1.77162 WP_000683129.1.77462 WP_000683129.1.78445 WP_000683129.1.78481 WP_000683129.1.78891 WP_000683129.1.7901 WP_000683129.1.79067 WP_000683129.1.79591 WP_000683129.1.80440 WP_000683129.1.81026 WP_000683129.1.811 WP_000683129.1.81283 WP_000683129.1.81580 WP_000683129.1.81715 WP_000683129.1.82137 WP_000683129.1.82647 WP_000683129.1.83584 WP_000683129.1.8470 WP_000683129.1.84893 WP_000683129.1.85155 WP_000683129.1.85752 WP_000683129.1.86210 WP_000683129.1.86437 WP_000683129.1.86768 WP_000683129.1.87728 WP_000683129.1.89710 WP_000683129.1.89915 WP_000683129.1.90332 WP_000683129.1.91290 WP_000683129.1.9157 WP_000683129.1.91782 WP_000683129.1.92058 WP_000683129.1.92195 WP_000683129.1.92781 WP_000683129.1.94764 WP_000683129.1.94808 WP_000683129.1.95062 WP_000683129.1.95400 WP_000683129.1.96086 WP_000683129.1.96341 WP_000683129.1.96479 WP_000683129.1.9657 WP_000683129.1.9661 WP_000683129.1.96659 WP_000683129.1.96944 WP_000683129.1.97231 WP_000683129.1.97459 WP_000683129.1.97490 WP_000683129.1.97711 WP_000683129.1.98241 WP_000683129.1.99046 WP_000683129.1.99304 WP_000683129.1.99453 WP_000683129.1.99471 WP_000683129.1.99592 WP_000683129.1.99632 YP_006780188.1.12065 gi|218694230|ref|YP_002401897.1| gi|170020113|ref|YP_001725067.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]