SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218694492|ref|YP_002402159.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218694492|ref|YP_002402159.1|
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.91e-50
Family Lambda phage gpU-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|218694492|ref|YP_002402159.1|
Sequence length 132
Comment Minor tail protein U [Escherichia coli 55989]
Sequence
MKHREIRTAVLSALKDNISERVSWFDGRPVFIDEQELPAVAVYLTDASAADEFVDEGTWE
ATLHIEVFLRAKEPDSALDMWMEEKILPALEAVPGLSALLLKMNLQGYDYRRDDEFMMWG
SADLLWKITYEM
Download sequence
Identical sequences A0A0K3ST51 B7LET6
WP_000682719.1.100571 WP_000682719.1.100752 WP_000682719.1.100778 WP_000682719.1.10651 WP_000682719.1.12979 WP_000682719.1.13301 WP_000682719.1.13437 WP_000682719.1.14993 WP_000682719.1.18164 WP_000682719.1.18666 WP_000682719.1.19758 WP_000682719.1.19838 WP_000682719.1.2093 WP_000682719.1.24560 WP_000682719.1.24783 WP_000682719.1.25718 WP_000682719.1.27786 WP_000682719.1.2954 WP_000682719.1.29740 WP_000682719.1.29840 WP_000682719.1.32435 WP_000682719.1.32724 WP_000682719.1.32946 WP_000682719.1.34397 WP_000682719.1.35006 WP_000682719.1.35464 WP_000682719.1.36500 WP_000682719.1.39305 WP_000682719.1.4172 WP_000682719.1.42480 WP_000682719.1.44029 WP_000682719.1.44960 WP_000682719.1.45930 WP_000682719.1.46070 WP_000682719.1.46477 WP_000682719.1.46614 WP_000682719.1.48188 WP_000682719.1.48385 WP_000682719.1.48615 WP_000682719.1.49481 WP_000682719.1.506 WP_000682719.1.50715 WP_000682719.1.54072 WP_000682719.1.54708 WP_000682719.1.54798 WP_000682719.1.54817 WP_000682719.1.55144 WP_000682719.1.56721 WP_000682719.1.60698 WP_000682719.1.61360 WP_000682719.1.62642 WP_000682719.1.64150 WP_000682719.1.6469 WP_000682719.1.6676 WP_000682719.1.68053 WP_000682719.1.69649 WP_000682719.1.70582 WP_000682719.1.73908 WP_000682719.1.75138 WP_000682719.1.76039 WP_000682719.1.76705 WP_000682719.1.77437 WP_000682719.1.77551 WP_000682719.1.80043 WP_000682719.1.8074 WP_000682719.1.81267 WP_000682719.1.82378 WP_000682719.1.83033 WP_000682719.1.85105 WP_000682719.1.85335 WP_000682719.1.85369 WP_000682719.1.86263 WP_000682719.1.86674 WP_000682719.1.87059 WP_000682719.1.87639 WP_000682719.1.88685 WP_000682719.1.89111 WP_000682719.1.89646 WP_000682719.1.90435 WP_000682719.1.91630 WP_000682719.1.91644 WP_000682719.1.96562 WP_000682719.1.98908 WP_000682719.1.99302 585055.EC55989_1067 gi|218694492|ref|YP_002402159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]