SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218694813|ref|YP_002402480.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218694813|ref|YP_002402480.1|
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 2.2e-50
Family Lambda phage gpU-like 0.000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218694813|ref|YP_002402480.1|
Sequence length 131
Comment Minor tail protein U [Escherichia coli 55989]
Sequence
MKNTDIRAAVLDALEQHEHGATLFDGRPVVFDEEDFPAIAVYLTDAEYTGEELDADTWRA
TLHIEVFLPAQVPDSELDQWMESRIYPAMTAIPALAGLITTMVTQGYEYRRDDDMALWSS
ADLTYSITYEM
Download sequence
Identical sequences B7L474
WP_000798775.1.11982 WP_000798775.1.24583 WP_000798775.1.24899 WP_000798775.1.3193 WP_000798775.1.42936 WP_000798775.1.44029 WP_000798775.1.6061 gi|218694813|ref|YP_002402480.1| 585055.EC55989_1399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]