SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218695103|ref|YP_002402770.1| from Escherichia coli 55989

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218695103|ref|YP_002402770.1|
Domain Number 1 Region: 7-136
Classification Level Classification E-value
Superfamily Phage tail protein-like 9.68e-51
Family Lambda phage gpU-like 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|218695103|ref|YP_002402770.1|
Sequence length 137
Comment Minor tail protein U [Escherichia coli 55989]
Sequence
MADPMNRHTQIRQVVLARLREQCGDSATFFDGLPAFVDAQELPAVAVWLSDAQYTGKMTD
DDDWQAVLHIAVFIRAQAPDSELDMWMESTIFPALNDVPALSGLIDTLIPLGFNYQRDNE
MATWAMAEITYQITYTN
Download sequence
Identical sequences B7L8P5
WP_012601988.1.31419 WP_012601988.1.40712 WP_012601988.1.41778 WP_012601988.1.44029 WP_012601988.1.53535 WP_012601988.1.61893 WP_012601988.1.99110 gi|218695103|ref|YP_002402770.1| 585055.EC55989_1702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]