SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Kwal_3401 from Kluyveromyces waltii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Kwal_3401
Domain Number 1 Region: 656-850
Classification Level Classification E-value
Superfamily Sec7 domain 1.44e-70
Family Sec7 domain 0.00000448
Further Details:      
 
Domain Number 2 Region: 1189-1525,1651-1700
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000154
Family MIF4G domain-like 0.061
Further Details:      
 
Weak hits

Sequence:  Kwal_3401
Domain Number - Region: 102-149,178-270,399-498
Classification Level Classification E-value
Superfamily ARM repeat 0.000157
Family Plakophilin 1 helical region 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Kwal_3401
Sequence length 1795
Sequence
MTQKEAQPASSETPTVSVDQGDVPTTPTAAQQDNSPTSHSPVKAANGGHSRQASNISVGQ
NNLRSTVVLVKSTFESILQQKEIKKHVDTQKSLERSIQKLDEMMTSTNNDPKFLDSILIF
EPLRLSCRTKSTGIVINALDCMSKLFSFQALDDSIMVYPPNAMASNDQENAAVTGITPPP
KQKLIDAAIDTITDCFEGEGTDARVELQILRALASCILTDNAVTLCHGQSLLKAIRQIYN
IFIYSLSSSNQGIAQATLTQVVNSVFDRLNSGLVTAPFLNAGLSRTSLKGPPSESPDIAP
ETPDKPLTLQNLETLNDEQERIVDEAQHEEIEDEKTLLIKDAFLVFRAMTKISAKPLEND
TDMRSHAVRSKLLSLHIIHSIIKDHIDVFLAQDLILPGKENNSLVDAVRQYLCLLISRNA
ASPISPVYEITLEIMWLLISNLRSEFKREIPVFLTEIYFPITDLKSSTAHQKRYFLSVMQ
RVCNDPRTLIEFYLNYDCDTHLPNVVEIIVDYLTRMALTRVEITPSQRMYYEEQRAKPLA
TYNLAQLPLLSISSLSSANNNDNVNFPVEFALKMTSLSCMVAVLRSLSSWAHKALNPNDP
AAINSRLRGASASTVTGRKPLSANSSSFDVNGDATGSMSGQEEQSQVDNSEEGDDPTQFE
NLKIRKNELQDCINMFNYKPKRGIKVLVERKFIPDDSPASIAKWLSEAEGLDLAAVGDYL
GEGDEKNIATMHAFVDELDFSKKSLVDALRVFLQKFRLPGEGQKIDRYMLKFAERYVEQN
PGHFAKAETAYVLSYSIIMLNTDLHSSHIKNKMTLQEFIENNAGIDNENDLPKEYMVGLY
NEIAQNEIKLQSEQHQAMLSGDVNPAQQQQSAFNFFSSRDLNREAYMQVSKEISSKTELV
FKNLTRQRGKESHVYYAASHIEHVKSVFDTLWMSFLAALTPPFKEYDDAATTEMCLEGIK
ISIKISATFGNDYARTSFVGALVQLANLQNMQEIKVKNVNATVVLLDLALTEGNFLKKSW
KDILLIVSQVERLQLISKGIDGQSLPDVSQARLANNRSSFDSNRSASMGFFERWTKKSTP
MELAQEKHHNQTLGPEISKYISSSHLVVLIDRIFTNSSSLTGTAIVDFIKALTEVSFEEI
ESSQHAASPRMFSLQKMVDVCYYNMDRIRVEWTPIWAVMGEAFNRIGTNSNLAVVFFAID
SLRQLSMRFLDIEELTGFEFQHDFFKPFKYITYHTADTEVQEMCVECFKNFILTKSSKIK
SGWKPILESLQYTAKSQNEAIVMKTYQLVASDIVKNHFESVFAQDNAFVDLVTVLKEITK
NQKFQKLSLHSLEVLKRITQKVADECFKKDSNTSLHGKDLFQDVWFPVLFCFNDTIMTAE
DLEVRSRALNYMFDALVAYGGEFDDTFWTSICTKLLFPIFGVLSKHWEINQFNSHDDLSV
WLSTTLIQALRNMVALFTHYFSCLNKLLDGFLGLLVSCICQENDTIARIGRSCLQHLILQ
NISKFNELHWSQITAAFSRFFELTTANELFEMDPLRQGRKKSVPNAHSAKENTVQQEVER
AHQEEEGEDVGNANTEAEKPSKRLVKTKSSEDLRRRISAKNAIVVKCVLQLLMIESLSEL
FEDDSFSNHIPYQEAIKLTNMLENTYEFARDFNDDFELRTRLLNARLVDKIPNLTKQETS
AAAVLLNIMFKLFLNSENESAEEKKELSERLISISVRVVQKYVSLDDRSTERDITAWRPV
VVEILQGYYEFDDSDFKENCPVMYDLAMQILDKSVPADLRLAIKEFLTRVGELYL
Download sequence
Identical sequences Kwal_3401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]