SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|549703088|ref|YP_008630839.1| from Streptococcus dysgalactiae subsp. equisimilis 167

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|549703088|ref|YP_008630839.1|
Domain Number - Region: 188-289
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0379
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|549703088|ref|YP_008630839.1|
Sequence length 377
Comment transposase [Streptococcus dysgalactiae subsp. equisimilis 167]
Sequence
MIDFIISIDDCAVELDSRQSWKIRYPLSTILFLVFVCQLAGIETWKEMEDFIEMNEPLFA
TYVDLSEGCPSHDTLERVISLVNSDRLKELKVQFEQSLTSLGAVHQLISVDGKTIRGNRG
KNQKPVHIVTAYDGGHHLSLGQVAVEEKSNEIVAIPQLLRTIDIRKSIVTIDAMGTQTAI
VDTIIKGKADYCLAVKGNQETLYDDIALYFSDVNLLEELQENAQYYQTVEKSRGQIEVRE
YWVSSDIKWLCQNHPKWHKLRGIGMTRNTIDKDGQLSQENRYFIFSFKPDVLTFANCVRG
HWQIESMHWLLDVVYHEDHHQTLDKRAAFNLNLIRKMCLYFLKVMVFPKKDLSYRRKQRY
ISVHLEDYLVQLFGERG
Download sequence
Identical sequences A0A0E9GDQ4 A0A223M031
gi|549701218|ref|YP_008628969.1| gi|549701336|ref|YP_008629087.1| gi|549701693|ref|YP_008629444.1| gi|549702377|ref|YP_008630128.1| gi|549702528|ref|YP_008630279.1| gi|549703082|ref|YP_008630833.1| gi|549703088|ref|YP_008630839.1| WP_022554244.1.16737 WP_022554244.1.18947 WP_022554244.1.19979 WP_022554244.1.20622 WP_022554244.1.31708 WP_022554244.1.4021 WP_022554244.1.5282 WP_022554244.1.7962 WP_022554244.1.93189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]