SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327310829|ref|YP_004337726.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310829|ref|YP_004337726.1|
Domain Number 1 Region: 84-365
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.21e-37
Family RecA protein-like (ATPase-domain) 0.0033
Further Details:      
 
Domain Number 2 Region: 643-697
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000746
Family FHA domain 0.0025
Further Details:      
 
Weak hits

Sequence:  gi|327310829|ref|YP_004337726.1|
Domain Number - Region: 221-246,364-474
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00117
Family Nucleotide and nucleoside kinases 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327310829|ref|YP_004337726.1|
Sequence length 704
Comment type II secretion system protein E [Thermoproteus uzoniensis 768-20]
Sequence
MVSTYNVGISTIKIVDTGASYMYVVEDPPVPEKSLKKLGAALAKISEEVEDPGLFLDLSR
REEASKYLRGRLAKLGIKDATLVALAERELLGFGPLDPVLRDKKLENVECKGPDLPLNVV
HTEYGRLETNMKFSKGELDKLIQRLVFLTGKTISVSNPKIDNAFLQGVGRLTATFGEEIS
RGSSFVVRIFPEKPWTVLGLLERGTVSPELLAYLWLAVEYKMPILIAGEMGSGKTSYANA
ILGLAPPDKRIGTAEDIPEFRIPHKNWQAYYTDDKRGIGLMDLVALLLRANVDYVVINEI
RGARNQKGEVDAAAWFQAVATGHGGVTTIHADTVEDVFNRLDHMGIPPAYLTSLALVVYI
GRFKIGGRIQRRTQYVFDIIDPSKRLYNVLFEYDREGDRYVAKGLETARTTQRIMELAKW
DLEKFKSEYAKRVDFLGRLMCLNRKKPIQTLDELADLFARFYRGYVPEVSDCPPPKQQEA
RKAEGVAADWILKFKLPRGRKVIYFEPSPGLTLLNVEGTSKVVEEEVFELKARGSGELRY
RVELDGKVIDQKAIPLLKSDARLTAPTQKVDALEVPRMPAPPAPQPGGERLQSEETVVWE
ETRLLEETLVASDMCIKFGGGVLKLVDGKIYGRADFAFLGDLSSYVSRQHFKALLKEGRW
YLEDLGSRNGLYINGVRASPGTPVEIAYGAKIKVGKAEGVVEPC
Download sequence
Identical sequences F2L5W9
gi|327310829|ref|YP_004337726.1| WP_013679750.1.87035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]