SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|327310832|ref|YP_004337729.1| from Thermoproteus uzoniensis 768-20

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327310832|ref|YP_004337729.1|
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.19e-53
Family Protein kinases, catalytic subunit 0.0011
Further Details:      
 
Domain Number 2 Region: 283-380
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000124
Family FHA domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|327310832|ref|YP_004337729.1|
Sequence length 394
Comment serine/threonine protein kinase [Thermoproteus uzoniensis 768-20]
Sequence
MSGLLEVGAVLGDKYVVKKLLGKGGMAIVWLAERKDGLKVAVKEPIISGEPEEKIKRNIQ
FVEHEGRILEMLNSPYICRLYDVKRGRVGAISTILLFLEYLDGGSLRELREPVDSNKLRD
IAIQIFEGLAEVHKAGVVHRDVKPSNVMRGGDVYKLVDFGTAVYHFEKATHIVVSPGGYT
APEQLTRGLSVPQADVWSAGATLVWAYTLKHPYKFIKGYDVDKIVGELQVNIPSTYDDLM
DKFLARTLEPDYRKRFSDAVEALNFLKGIATKEKVGLKIRIKGTSIYMTGGRLIIGRTED
KALDLKIEGERLYIYDPQKYISREHAEIAEIGGRWVIRDSGSTNRTAIYRDGNWKVLWKG
RGKPSQWEELRDGDIIAFGYDDEKGAYITAKVEL
Download sequence
Identical sequences F2L5X2
WP_013679753.1.87035 gi|327310832|ref|YP_004337729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]