SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PDK_20s1398131g001 from Phoenix dactylifera

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PDK_20s1398131g001
Domain Number 1 Region: 172-318
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.91e-20
Family Polyphosphate kinase C-terminal domain 0.093
Further Details:      
 
Domain Number 2 Region: 9-48,78-111
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000000000000239
Family Phospholipase D 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PDK_20s1398131g001
Sequence length 395
Comment [locus_tag="PDK_20s1398131L001"] [product="phospholipase d"] [strand="+"]
Sequence
MYQYSTVVGTLFTHHQKCLLVDTQASRNNRKITAFMGGLDLCDGRYDTPQHRIFSELDSV
FLNDFHNPTFADATKGPRQPWHDLHCKIEGPAAYDILTNFEQRWRKATKWQEFGKRFKRV
SHWSDDALIKLERISWIVFRSIDSGSVKGFPKDVHEALEKNLVCRKNLVIDKSIHTAYVR
AIRSAQHFIYIENQYFLGSSYGWPSYKNAGFLISLLFMDDQHIGAPLYRVLVQYRYGMAL
CQKFRRFMVYVHAKGMIVDDEYVILGSANINQRSLSGSRDTEIAMGAYQPHHTRAETKRH
PHGQVYGYRMSLWAEHLGMVDEHFKEPNSIDGISSLERFNRAIGSETINVPELRPRSNLI
LISTAPGMQSVIEIACPTLLNHVLLRARELVLAPV
Download sequence
Identical sequences PDK_20s1398131g001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]