SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000003 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000003
Domain Number 1 Region: 72-145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.86e-16
Family Complement control module/SCR domain 0.0006
Further Details:      
 
Domain Number 2 Region: 136-202
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000126
Family Complement control module/SCR domain 0.00043
Further Details:      
 
Domain Number 3 Region: 193-259
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000375
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 4 Region: 10-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000109
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000003   Gene: ENSLAFG00000000003   Transcript: ENSLAFT00000000003
Sequence length 286
Comment pep:novel supercontig:loxAfr3:scaffold_13:13126231:13143635:1 gene:ENSLAFG00000000003 transcript:ENSLAFT00000000003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLTSFSLDACGAPTRYETMKLRDPPKDHYTPGESVVYQCRLGYRIKPSFAMTAVCNDSNS
WTPLQEACAKKLCSNPGDPVNGRVIQTNGTLEFGSQVDYVCDEGYRLIGEKTSYCYIYED
SVAWSSERPECNRIMCAPPPNIENGQYRNSEKEVYEYNEVVHYSCRSADYSLIGNERLIC
STNGEWSTEPPKCKVVKCPFPRVDNADRIAGFGTKFVYKSKVVFQCHEGFVMNGSDTITC
EGDSLWVPPVPQCVKVSTPPSTKPPILSHPVSTLPKTTSPVSSHPG
Download sequence
Identical sequences G3SKX6
ENSLAFP00000000003 ENSLAFP00000000003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]