SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000127 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000127
Domain Number 1 Region: 630-785
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-17
Family Laminin G-like module 0.024
Further Details:      
 
Domain Number 2 Region: 427-604
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-16
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 832-1031
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000574
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 4 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000272
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 5 Region: 111-153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000607
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 311-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 7 Region: 187-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000602
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 8 Region: 1176-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000988
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 9 Region: 1061-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 10 Region: 77-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000458
Family EGF-type module 0.012
Further Details:      
 
Domain Number 11 Region: 227-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000002
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 12 Region: 1096-1135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000839
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000000127
Domain Number - Region: 1143-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000124
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 806-845
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000167
Family EGF-type module 0.0076
Further Details:      
 
Domain Number - Region: 265-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0259
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 849-874
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0389
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000127   Gene: ENSLAFG00000000156   Transcript: ENSLAFT00000000157
Sequence length 1287
Comment pep:novel supercontig:loxAfr3:scaffold_6:34666308:34683319:-1 gene:ENSLAFG00000000156 transcript:ENSLAFT00000000157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSAPEFCPERQTTPVLLLSVMCLPTLTSQCPLSTGELPSEIPSACASDPCAPGMECRTTE
NGGYTCGPTEPQGCATQPCHHGALCVPQGPDPNGFRCYCVPGFQGPHCELDINECASRPC
HHGATCRNLADHYECHCPLGYTGVTCETEVDECASVPCLHGGSCLDGVGSYRCVCAPGYG
GASCQLDLDECQSQPCAHGGICHDLVNGFQCDCADTGYEGVRCEEEVLECASAPCAHNAS
CLEGLGSFRCLCWARGYSGERCEVDEDECAAGPCQHGGQCLQRSEPGLYGGAQAVFSGAF
SFRHAAGFLCRCPPGFEGDDCSVDVDECASQPCISGGRCQDLPNGFKCHCPDGYTGLTCQ
EDVDECLSEPCLHGGTCHDTVAGYTCWCPEPWDGHDCSVQLTGCQGHTCPLATTCIPIFE
SGVHSYICRCPPGTDGPFCGQNTTFSVAAGSPVWASVPAGSPLGLALRFRTTLPAGALAT
RTDTQDSLELALLGATLQATLRSHGVTVLILRLPDLALNDGHWHQVEVALRFGTLELRLW
HEGCPARLCVASGPVALAPMSSVAPSPAGLCSTQLGGAAFGGCLQDVRVGYLLLPEELGN
VLLGCERHEQCQPLPCAHGGACMDLWTDFHCDCPRPYSGPKCTDEVPAATFGLGGTLSSA
FFLLHEPPGPNITISFLLRTREPAGLLLQFANDSAAGLTVFLSGGQIRAEALGSPVLELP
GPWDDGLRHLVTLSFGPNQLQGLGQQVHVGGGLLPAESQPWGGPFRGCLQDLQLNGLHLP
FFSLSLGNLSEPSKLDSRQTQNLTLGCVSEDMCSSNPCLNGGTCLVTWNDFHCTCRANFT
GPTCAQQLWCPGQPCLPPATCEEVPDGFICVAETTFLEGPPAEFSGHNVSAVHTFGGLSL
AFRTRDLEAQLLSAAAGAHASVWLAVRNGSLAAGVRSGLELPGAVLSAPGPRVADGAWHR
VSLAMEHPAAAASRWLLQLDDALTPVALRGLAGDLDFLRGPGAARILLAENFTGCLGRVA
LGGLPLPLAHPRPGAAPDSGERFAAWPGKPAPRLGCRGAPVCAPTPCLHGGTCRDLFDAF
ACACGAGWEGPRCEVPADPCRSAPCARGRCQARPDGHFECRCPPGFVGPRCRLPVLLEEC
GLNFTCLNGGRCEAGPWGANCSCQEGFAGRRCQIPIFPCEANPCLNGGTCRAAGGEYECT
CSATFSGQFCEVVKGLPLPQPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTY
SPSQQEVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences G3SL69
ENSLAFP00000000127 ENSLAFP00000000127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]