SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000435 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000435
Domain Number 1 Region: 443-571
Classification Level Classification E-value
Superfamily eIF1-like 4.05e-21
Family eIF1-like 0.0082
Further Details:      
 
Domain Number 2 Region: 372-472
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.53e-16
Family SWIB/MDM2 domain 0.01
Further Details:      
 
Domain Number 3 Region: 93-181
Classification Level Classification E-value
Superfamily PUA domain-like 0.000000000000028
Family PUA domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000435   Gene: ENSLAFG00000000517   Transcript: ENSLAFT00000000519
Sequence length 581
Comment pep:novel supercontig:loxAfr3:scaffold_13:11746200:11769485:-1 gene:ENSLAFG00000000517 transcript:ENSLAFT00000000519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTKAFRVKSNTAIKGSDRRKLRADVTAAFPTVGTDQVSELVPGKEELNVVKLYAHKGDA
VTVYVSGGNPILFELEKNLYPTVYTLWSYPDLLPTFTTWPPVLEKLVGGADLMLPGLVVP
PAGLPQVQKGDLCAIALVGNRAPIAIGVAAMSTAEMLTSGLKGRGFLVLHTYQDHLWKSG
DKSSPPSIAPPAEGLADLGEEKDSVQADPSLQEDMRHLHLEGEAEENGELLQLCGEKVSE
DPDVGALDQDTRGSKTLQEQMDELLQRCFLHALKSRVRKADLPLLASTFLGSHMFSCCPE
GRQLDIKKSSYKKLSKFLQQMQQEQVIQVKELSRGVESIVAVDWKHPRITSFITPEPSQT
SQTIQEGSREQPYHPPDIKFLYCVPAGMTLLFQESGHKKGSFLKGSEVRTAIINYAKKND
LVDADNKNLVKLDPVLCDCILEKNEQHTVLKLPWDSLLTRCLEKLQPAYQVTFPGQEPIV
KKGKICPIDIILAQRASNKKVTIVRNLEAYGLDPSLVAAILQQRCQASTTVTPAPGAKDS
MQVQIQGNQVHHLSRLLLDEYQLPRKHIQGLEKAPKPGKKK
Download sequence
Identical sequences G3SLV4
ENSLAFP00000000435 XP_003410321.1.64505 ENSLAFP00000000435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]