SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000602 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000602
Domain Number 1 Region: 267-396
Classification Level Classification E-value
Superfamily Second domain of FERM 3.93e-31
Family Second domain of FERM 0.0018
Further Details:      
 
Domain Number 2 Region: 398-503
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-23
Family Third domain of FERM 0.0069
Further Details:      
 
Domain Number 3 Region: 42-138
Classification Level Classification E-value
Superfamily PDZ domain-like 1.25e-16
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 180-261
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000379
Family Ras-binding domain, RBD 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000602   Gene: ENSLAFG00000000712   Transcript: ENSLAFT00000000714
Sequence length 1578
Comment pep:novel supercontig:loxAfr3:scaffold_6:62528452:62579935:-1 gene:ENSLAFG00000000712 transcript:ENSLAFT00000000714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELESNLFQTRKAHRIEQMVARWLRRSRDSSARAKVAAADVSPGNPTQTLTPVRHTVKI
DKDALLQDYGFHISESLPLTVVAVTAGGTAHGKLFPGDQILQMNNEPAEDLSCERAVDIL
REAEDSVSITVVRCTSGVPKSSFLTEEKRARLKTNPVKVHFAEEVLISGHGQGNSLLCMP
NVLKLYLENGQTKAFKFDANTTVKDIILTVKEKLSIRSIEYFALALEEQYSVSRLHLLHE
EELIQQVVEREESHDYRCLFRMCFVPKDPLDLLKEDPVAFEYLYLQSCSDVLQERFAVEM
KCSSALRLAALHIQERIYACAQPQKISLKYIEKDWGIENFISPTLLRNMKGKDIKKAISF
HMKRNQNLLEPRQKQLISAAQLRLNYLQILGELKTYGGKIFNATLMLQDRESYIALLVGA
KYGISQIINSKLNIMSTLTEFANISRIELMEESEKVSMVKVYLQDIKVLTLLLESNSAKD
LACLIAGYYRLFVDPVTSIFIWPGNKQQVHRVSAEEGYESRACSDSEESSEVDCVLEPLS
DRCLVKLVPCTPLMQEEEQEPPGDSAIPEVARRGPSICGASSVTDSAESEASDSANTESR
GCRTSGSSESMDALEEDDLDACSSSRSDFFHFGSSGFPKSLDSDSQEERSRIETSDFLYL
LDLAQRASPQCQKTDFSESPAPEMFSWGPELSAVRLDPRLYEGSRADYYSLCSSVSSASH
LSDSSESTASRQGCPLLAWGQQGWPEAQPSSTLEALALHPTLAFEDGSSDEEYYDAADKL
TPPDTLSGPRAVSALEPSATSLQRKAGACNPEDSLNPGPHGPEPNRRGGVKKYAKTLRKR
RSFLQTDYTSQVSFPLMPSASLESVDNVCYYDREPYLALGVPSPTVSSLQDMQGEPGLLE
TKALGLLAPLMEAKSKNPASRVMEMEPETMETKSVIDSRVSSISAIRLRVDPNHKENSGV
APLTVPVTSSPASTPQCSNPGSSGPDTAQAGPSQTLPPCQDPNGTAPKEVTMEPGDSTSL
FSADPTPDGVCLAINSGPHNVSQGDTLELGAVQMETGLGSLFINHMQETTPKYTEPWLSP
GDQPRSAECGINSGEKMASFPTKEEQQGQISLESDRKVTNKNDTNLFQEDSGKDSGDPSG
DLSDAVSQALGVKGPAGEIIAYLSLEAAVTGTEQTPAHPARAPQGQSRETPGQACQTQEQ
KLLAGLDLDTDFLLGDQATPSALPPEGVKAELLNCVRGEDTAPADTVPQVCFNPGPFLTN
PPLCPQEEPGLENSNTCSPSESKGKSICPPARKSLLCFASGNHPGVSARPGMTTSLGFAG
INDAVAPRIGMEQCSCQFSYATCFRGPQPEMEEEDRDSEAHSKAPLTSPPSAGSPLALPW
RPARAHSCSTEPLWRKSHIWPEYCSRALRQLKAAPTNTPEGFLQLTESLLELQDILEASW
GDGKKHPPEKCTWHFSESRSRLCMGSQKLLSSCQHVIRTDQSPEEMQGAVHDTFQHLVQL
AGLCFQLTDCSRCSARHREAAGNLRDVVYTYCQFVEAAKLTCERGYHDLSVKLLARQCTA
LTASVFCLTHKFRASTAL
Download sequence
Identical sequences G3SM86
ENSLAFP00000000602 ENSLAFP00000000602 XP_003407900.1.64505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]