SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000616 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000616
Domain Number 1 Region: 102-167
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000166
Family Ovomucoid domain III-like 0.0014
Further Details:      
 
Domain Number 2 Region: 198-243
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000194
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 3 Region: 36-73
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000235
Family TB module/8-cys domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000616   Gene: ENSLAFG00000000731   Transcript: ENSLAFT00000000731
Sequence length 262
Comment pep:novel supercontig:loxAfr3:scaffold_153:398444:402809:1 gene:ENSLAFG00000000731 transcript:ENSLAFT00000000731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPGAPGPLWPLPWGALAWTVGFVGCVSSGDPAPGGVCWLQQGREATCSLVLQTDVTQEE
CCASGSVDTAWSNFTYPGNKISLLGFLGLVHCVPCRDSCEGVECGPGKACRMLEGRPRCE
CAPDCTGLPARLQVCGSDGATYRDECELRAARCRGHPDLRVMYLGRCRKSCAHVVCPRPQ
SCVVDQTGSAHCVVCRSAPCPVPSSPGQELCGNNNVTYISSCHLRQATCFLGRSIGVRHP
GGCTGNPQLSDAESDHEEENFV
Download sequence
Identical sequences G3SM98
XP_003422587.1.64505 ENSLAFP00000000616 ENSLAFP00000000616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]