SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000617 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000617
Domain Number 1 Region: 7-239
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.97e-70
Family Eukaryotic proteases 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000617   Gene: ENSLAFG00000000733   Transcript: ENSLAFT00000000732
Sequence length 241
Comment pep:novel supercontig:loxAfr3:scaffold_153:405862:410004:-1 gene:ENSLAFG00000000733 transcript:ENSLAFT00000000732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APAGSWGAHIIGGHEVAPHSRPYMASVRFEGQHHCGGFLLRAQWVVSAAHCFSNRDPVDG
LVVLGAHDLRIPEPTQQVFSIKEAFRHPDYQLSSHANDICLLKLNGSAVLGSDVGLLKLP
RRGAGLPKAEARCRVAGWGFTSDFQDAPPGLMEVEVRVLGLDACNSSWSGQLSPAMLCTH
SGDRQRRGFCTADSGGPLVCKSRAHGLVSFSGFWCGDPKYPDVYTQVSAFVTWIWGVVRS
A
Download sequence
Identical sequences G3SM99
ENSLAFP00000000617 ENSLAFP00000000617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]