SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000675 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000675
Domain Number 1 Region: 9-145
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-48
Family Galectin (animal S-lectin) 0.0000819
Further Details:      
 
Domain Number 2 Region: 187-319
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-46
Family Galectin (animal S-lectin) 0.0000456
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000675   Gene: ENSLAFG00000000809   Transcript: ENSLAFT00000000809
Sequence length 320
Comment pep:novel supercontig:loxAfr3:scaffold_31:153987:163814:-1 gene:ENSLAFG00000000809 transcript:ENSLAFT00000000809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTFSSLQSVPFQGTILGGLQDGLQIIIKGAVLSSSGSRFSVNFQTGSDEKDIAFHFNPR
FEEGGYVVCNTKQKGSWGPEERKMQMPFQKGQPFEICVLVQSPDFKVAVNGSHFLQYSHR
VPFHRADTISVQGALRLYSIEFQPPDIWSVNSAPIGQTIIHTMHSTPGWVFPNPTIPPMV
YSSPSPTYLVPYFTAIPGGLYPSKSIIVSGTILPNAQRFHINLRSGSDIAFHLNPRFNEN
TVVRNTQINSSWGSEERWLPGKMPFNRGQNFLVQILCESFCFRVAVNNQHLCEYNHRLKN
LPAINNLEVAGDIQLTHVQA
Download sequence
Identical sequences G3SME3
ENSLAFP00000000675 ENSLAFP00000000675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]