SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000694 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000694
Domain Number 1 Region: 822-872
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000949
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 2 Region: 870-918
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000176
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 3 Region: 384-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000262
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 4 Region: 916-968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0035
Further Details:      
 
Domain Number 5 Region: 320-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000942
Family Laminin-type module 0.034
Further Details:      
 
Domain Number 6 Region: 1025-1075
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000117
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 7 Region: 977-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000212
Family Laminin-type module 0.073
Further Details:      
 
Domain Number 8 Region: 507-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 9 Region: 559-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1133-1175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 11 Region: 1077-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 12 Region: 1181-1228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000206
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 13 Region: 468-509
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000307
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 14 Region: 1610-1824
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000523
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000694   Gene: ENSLAFG00000000832   Transcript: ENSLAFT00000000833
Sequence length 1835
Comment pep:novel supercontig:loxAfr3:scaffold_5:77810712:77893553:-1 gene:ENSLAFG00000000832 transcript:ENSLAFT00000000833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAPLLSLNVFAFFSPPPLQKGRREKRSGGSPGVFSPPLPGPLGCRDPDMELLQVFAFGF
LALCGALVRAQEPEFSYGCAEGSCYPATGDLLIGRAQKLSVTSTCGLHKPEPYCIVSHLQ
EDKKCFICDSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVENVTIQLDLEAEF
HFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTGPMKKVDDIICD
SRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKITNLRIKFVKLHTLGDNLLDPR
MEIREKYYYAVYDMVVRGNCFCYGHASECAPVDGFNEEVEGMVHGHCMCRHNTKGLNCEL
CMDFYHDLPWRPAEGRNSNACKKCNCNEHSGTCHFDMAVYLATGNVSGGVCDDCQHNTMG
RNCEQCKPFYYQHPERDIRDPNTCERCTCNPAGSQNGGICDSYTDFSAGLIAGQCRCKLY
VEGEHCDVCKEAFYDLTAEDPLGCKPCACNPLGTVPGGNPCDSETGYCYCKRLVTGQHCD
QCLPEHWGLSNDLDGCRPCDCDLGGALNNNCSAESGQCSCRPHMIGRQCNEMESGYYFTA
LDHYIYEAEEANFGPGVSIVERQYIQDRTPSWTGAGFVRVPEGAYLEFFIDNIPYSMEYD
ILIRYEPQLPDHWEKAVITVQRPGKIPASSRCGNTVPDDDNQVVSLSPGSRYVVLPHPVC
FEKGVNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPYCKSLDIFTVGGSGDGLITNSAW
ETFQRYRCLENSRSVVKTPMTDVCRNIIFSISALLHQTGLACECDPQGSLSSVCDPNGGQ
CQCRPNVVGRTCDRCAPGTFGFGPSGCKPCECHLQGSVNAFCDPITGQCHCLQGVYARQC
DRCLPGYWGFPNCQPCQCNGHADDCDSVTGECLSCQDYTTGHNCERCLAGYYGDPIIGSG
DHCRPCPCPDGPDSGRQFASSCYQDPVTLQLACVCNPGYIGSRCDDCASGFFGNPSDVGG
TCQPCQCNHNIDTTDPEACDKETGRCLRCLYHTEGEHCQLCRFGYYGDTLQQECRKCVCN
NLGTVHEHCNGSDCQCDKTTGQCLCLPNVIGQNCDRCAPNTWQLASGTGCDLCNCDAAHS
FGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECRACDCDSRGIETPQCDQSTGQC
ICVEGVEGPRCDKCTRGYSGVFPDCTPCHQCFALWDVIITELTNRTHRFLEKAKALKISV
VIGPYRETVDSVEKKVNEIKDILAESPAAEPLKNIGNLFEEAEKLTKDVAEKMAQVEAKL
SDTASRSNSTAEELDTLQTEAERLDNTVKELAEQLEFIKNSDVQGALDSITKYFQMSLEA
EERVNASTIGPNSTVEQSALTRDKVEDLMMERESQFREKQEEQSRLLDELAGKLQSLDLS
ATAEMTCGTPPGASCSETECGGPNCRTDEGQKKCGGPGCGGLVTVAHSAWQKAMDFDQDV
LSALAEVEQLSKMVSEAKLKADEAKQNAQEVLLKTNATREKVDKSNEDLRNLVKQIRNFL
TQDGADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRQRVESLSQVEVILQQSAADVARA
EMLLEEAKRASKSATDVKVTADMVKEALEEAEKAQIAAEKAIKQADEDIQGTQNLLTSIE
SETAASEETLNNASQRISELERNVEELKRKAAQNSAEAEYIEKVVYTVKQSADDVKKTLD
GELDEKYKKVENLIAKKTGESADARRKAEMLQNEAKTLLAQANSKLQVLKDLERKYEDNQ
KYLEDKAQELVRLEGEVRSLLRDISQKVAVYSTCL
Download sequence
Identical sequences G3SMF5
ENSLAFP00000000694 ENSLAFP00000000694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]