SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000818 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000818
Domain Number 1 Region: 51-202
Classification Level Classification E-value
Superfamily C-type lectin-like 4.9e-40
Family C-type lectin domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000818   Gene: ENSLAFG00000000977   Transcript: ENSLAFT00000000977
Sequence length 212
Comment pep:novel supercontig:loxAfr3:scaffold_15:52609712:52616811:-1 gene:ENSLAFG00000000977 transcript:ENSLAFT00000000977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLTESMEGDRHPKLIPWTIAVVFISLLSACFITSCLVTHRNFLRCERGTRGLKYHSKLT
CNKENSKLKGSTWNCCPVDWRAFQSNCYIILNDKKTWDESVKNCTGMGANLVTISTEAEQ
NFIIQSLDTQFSYFLGLTNQNTEGQWQWVDRTPFNPHLVFWHKGEPRNHQEEHCVVIVQE
KDKWGWNGFPCQFQTSRICKKPGRVFKWKPVF
Download sequence
Identical sequences G3SMQ2
ENSLAFP00000000818 ENSLAFP00000000818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]