SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000961 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000961
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily eIF1-like 1.09e-40
Family eIF1-like 0.000000787
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000961   Gene: ENSLAFG00000001140   Transcript: ENSLAFT00000001140
Sequence length 113
Comment pep:novel supercontig:loxAfr3:scaffold_36:3987:6151:-1 gene:ENSLAFG00000001140 transcript:ENSLAFT00000001140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Download sequence
Identical sequences A0A091DQG5 A0A0D9RWH5 A0A1A6H9Y4 A0A1D5R466 A0A1U7QZC2 A0A1U7TGF7 A0A212C975 A0A250XV20 A0A286XEI7 A0A2I3MK00 A0A2J8WY00 A0A2K5DBG4 A0A2K5KEK9 A0A2K5KW48 A0A2K5REL2 A0A2K5YRZ4 A0A2K6C1P2 A0A2K6FSZ6 A0A2K6JQW3 A0A2K6QX21 B5DFN1 F7EML2 F7G7W3 G1L4E0 G1PQ02 G1R0Y9 G3QZ21 G3SN16 G5ALW9 G7NYI7 H0Y0S4 H2QMC4 I3MIN8 J3S9Q0 K9IFW0 L5KEW1 M3Z2N5 O60739 P61220 Q32LJ9 Q4R4X9 Q6FG85 Q9CXU9 T1E4I2 W5NX86
ENSMPUP00000017847 ENSVPAP00000000892 NP_001001635.1.46622 NP_001032687.1.59421 NP_001032687.1.76553 NP_001100337.1.100692 NP_001100337.1.4139 NP_001244814.1.72884 NP_001274250.1.63531 NP_005866.1.87134 NP_005866.1.92137 NP_081168.1.92730 XP_001369253.1.35504 XP_002713137.1.1745 XP_002759802.1.60252 XP_003224004.1.98722 XP_003256937.1.23891 XP_003415741.1.64505 XP_003477044.1.53824 XP_003794532.1.62490 XP_003826115.1.60992 XP_004018289.1.66739 XP_004033955.1.27298 XP_004277903.1.21590 XP_004377363.1.4749 XP_004412166.1.74151 XP_004419600.1.5094 XP_004581437.1.84141 XP_004640710.1.9945 XP_004676344.1.23501 XP_004708619.1.18182 XP_004780302.1.14098 XP_004835178.1.39548 XP_005082385.1.91757 XP_005278639.1.60341 XP_005317461.1.77405 XP_005348173.1.66349 XP_005383637.2.28644 XP_005891124.1.15283 XP_006042641.1.26621 XP_006099806.1.53796 XP_006200731.1.17985 XP_006745120.1.47382 XP_006868811.1.41390 XP_006914875.1.64745 XP_006992087.1.50099 XP_007116522.1.24612 XP_007193488.1.59432 XP_007433701.1.37977 XP_007447404.1.90284 XP_007630624.1.28591 XP_007647866.1.69978 XP_007943929.1.48129 XP_007981926.1.81039 XP_008052062.1.4292 XP_008152948.1.99482 XP_008521024.1.77740 XP_008566478.1.73410 XP_008847653.1.79516 XP_010358340.1.97406 XP_010622823.1.5607 XP_010833776.1.44457 XP_010973092.1.51371 XP_011232364.1.58354 XP_011355704.1.92234 XP_011737114.1.29376 XP_011808655.1.43180 XP_011839699.1.47321 XP_011889579.1.92194 XP_012004475.1.54773 XP_012315573.1.9421 XP_012500869.1.63892 XP_012625657.1.48125 XP_014445946.1.99106 XP_014715134.1.49734 XP_015276607.1.55130 XP_015679168.1.16292 XP_015979449.1.101085 XP_017363829.1.71028 XP_017525595.1.32401 XP_017704248.1.44346 XP_017893918.1.57651 XP_019518261.1.44202 XP_019583134.1.88060 XP_019840603.1.53367 XP_020033059.1.5219 XP_020634033.1.8467 XP_020750237.1.74333 XP_020750238.1.74333 XP_020843037.1.61212 XP_021062916.1.100879 XP_021519748.1.76796 XP_021561523.1.83697 XP_516381.1.37143 ENSLAFP00000000961 ENSDORP00000012871 10090.ENSMUSP00000007139 10116.ENSRNOP00000025615 10141.ENSCPOP00000006212 13616.ENSMODP00000013845 28377.ENSACAP00000004293 9544.ENSMMUP00000023285 9598.ENSPTRP00000025478 9606.ENSP00000232905 9615.ENSCAFP00000007624 9823.ENSSSCP00000012016 9913.ENSBTAP00000025437 9986.ENSOCUP00000008878 ENSMUSP00000007139 ENSDORP00000012871 ENSMUSP00000007139 ENSSSCP00000012016 ENSVPAP00000000892 ENSRNOP00000025615 ENSCJAP00000032975 ENSMICP00000012050 ENSMMUP00000023285 ENSOARP00000002783 ENSETEP00000014044 ENSRNOP00000025615 ENSNLEP00000006860 ENSCPOP00000006212 ENSGGOP00000008119 ENSAMEP00000001750 ENSAMEP00000001750 ENSCPOP00000006212 ENSETEP00000014044 ENSPTRP00000025478 ENSPVAP00000013117 ENSP00000232905 ENSOGAP00000021967 ENSMODP00000013845 ENSSTOP00000010904 ENSMMUP00000023285 ENSMLUP00000013119 ENSNLEP00000006860 ENSSTOP00000010904 ENSTTRP00000000154 ENSMODP00000013845 ENSP00000232905 ENSMLUP00000013119 ENSMICP00000012050 ENSOGAP00000021967 ENSTTRP00000000154 ENSCJAP00000032975 ENSMUSP00000007139 gi|5031711|ref|NP_005866.1| ENSPTRP00000025478 ENSBTAP00000025437 HGL_H00000232905-1 ENSGGOP00000008119 ENSBTAP00000025437 ENSLAFP00000000961 ENSP00000232905 ENSOCUP00000008878 ENSMPUP00000017847 ENSSSCP00000012016 ENSPVAP00000013117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]