SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000000993 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000000993
Domain Number 1 Region: 143-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 204-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000612
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 90-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000305
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 4 Region: 7-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000267
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 5 Region: 513-590
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000044
Family Fibronectin type III 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000000993   Gene: ENSLAFG00000001177   Transcript: ENSLAFT00000001177
Sequence length 715
Comment pep:novel supercontig:loxAfr3:scaffold_6:47780423:47892885:1 gene:ENSLAFG00000001177 transcript:ENSLAFT00000001177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLDVCATCHEHATCQQIGGKKLCICNYGFVGNGRTECADKNECQFGAAVVCGNHTSCHNI
PGGFYCICLEGYRATNNHKTFIPNDGTFCTDVDECEVSGLCRRGGQCVNTHGSFECYCMD
GYLPKNGPEPFHPARDATSCTEIDCGTPPEVTHGYIIGNYTSTLGSEVHYVCQEGFFSGP
EDTVSTCTALGTWESPKLYCQEIDCGSPPEVQHAVLEWNRSSSLGSVAHYACQEGFESPG
GKITSVCTKEGTWRESASTCAEIMTEISDVLVFNNTCVRWKINPGRMNARIVYVISIKGQ
RLDPTESVHKEIVNLTTDSRTPEVCLDLYQGANYTVSISAAPPRRSVPAFIWFQTAEDDI
LEDDGIFNISIFNETCLKLKRTSMKVGSEQTYQQFKVLGQRWYLNNFYHATSFNFTTREQ
VPVVCLDLYPATDYSVNITLLASPKERSVQITIKTAPAVKQTIVNISVFNETCLKWRNIK
TADIEEMYLFHIWGQRWYQKEFAQEMVFNITTSSQAPQMCLDLHPGTNYNVSVLALSSKL
PVAISLTTQITEPPLPEVEFFIVHGRPVPPLKLRKAKEKNGPISSYQVLVLPLAFQSTFP
CDSEGAASFFSNATDADGYVTAELLAKDVPDDTIEIPIGDRLYYGKYYNAPLKIGNNYCI
ILRITSEWNKVRRYSCAVWAQVKGKAIFCLRMLSLFLPVQSAALNLCTSLSFFFF
Download sequence
Identical sequences G3SN42
ENSLAFP00000000993 ENSLAFP00000000993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]