SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001016 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001016
Domain Number 1 Region: 308-474
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-46
Family SPRY domain 0.000099
Further Details:      
 
Domain Number 2 Region: 8-83
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-18
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 94-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000504
Family B-box zinc-binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001016
Domain Number - Region: 129-204
Classification Level Classification E-value
Superfamily STAT 0.00608
Family STAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001016   Gene: ENSLAFG00000001199   Transcript: ENSLAFT00000001201
Sequence length 480
Comment pep:novel supercontig:loxAfr3:scaffold_122:2387675:2395909:-1 gene:ENSLAFG00000001199 transcript:ENSLAFT00000001201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAASVTSLVDEVNCPICQGTLREPVTIDCGHNFCRCCLTRYCEIPGQDPEEPPTCPLC
KEPFRPGGFRPNWQLASVVDNIERLKMVSSPGLAEEDACQEHGEKIYFFCEDDEMHLCVM
CREAGEHRAHTVRFLEDAAGPYREQIQKCLVCLRKEREEIQGIQSRENQRIQVLLTQVAT
KRQKVVSEFAHLSQFLEEQQNILLAQLERLDGDILKQREEFDFLVTDEICRFSTLIAELE
EKNERSSRELLTDIRSTLIRCETRKCRKPEAVSPELGQRIRNFPQQALPLQREMKTFLEK
LCFELDYEPAHVSLDPQTSHPKLLLSEDHQRARFSYKWQNSPDNPQRFDRATCVLAHRGF
TGGRHTWVVSIDLAHGGSCTVGVVSEDVRRKGELRLRPEEGVWAVRLAWGFVSALGSFPT
RLALEEQPRQVRVSLDYEVGWVTFTNDVTHEPIYTFTASFTGKVFPFFGLWGRGSNFCLS
Download sequence
Identical sequences G3SN62
ENSLAFP00000001016 ENSLAFP00000001016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]