SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001017 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001017
Domain Number 1 Region: 295-459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-50
Family SPRY domain 0.0000404
Further Details:      
 
Domain Number 2 Region: 71-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000275
Family B-box zinc-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 9-86
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000053
Family RING finger domain, C3HC4 0.048
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001017
Domain Number - Region: 99-131,174-239
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0235
Family Apolipoprotein A-I 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001017   Gene: ENSLAFG00000001203   Transcript: ENSLAFT00000001202
Sequence length 478
Comment pep:novel supercontig:loxAfr3:scaffold_122:2398565:2406285:1 gene:ENSLAFG00000001203 transcript:ENSLAFT00000001202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTPSLQTLREGATCSACTGPLKDAVTATCGHTFCRPCLPVPFQMGAHPSSRVLLCPFC
QQKEQPENLMVPLPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPSHQAHSVGLLD
EAIQPYRERLRSRLEALSMERDEIEDLKCREDQKLQVLLTQIETKKHQVEAAFKKLQQEL
GEQQRLLLAGLRELERQIWKERDEYIAKVSEEVARLGGHIKELEEKCQQPASELLKDVRV
NHSRCEMKTFVSPEAISPDLVNKIRNLHRKILPLPGMIRKFSENLVLHLETDSGGVTLDP
QTASRSLVLSEDRKSVRYTRQKQNLPDSPLRFDGLPVALGSPGFSSGRHCWQVDVQLADG
GGCMVGVARETVRRKGDMGLSAEEGVWAVILSHQQCWASTYPGIDLPLGEIPRRVGVSLD
YEAGRVTLHNAETRAPIFTFAASFSGKVFPLFAVWKKGSCLTLKGSKEWCSEESRALG
Download sequence
Identical sequences G3SN63
ENSLAFP00000001017 ENSLAFP00000001017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]