SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001036 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001036
Domain Number 1 Region: 1-207
Classification Level Classification E-value
Superfamily GFP-like 7.74e-60
Family Domain G2 of nidogen-1 0.0015
Further Details:      
 
Domain Number 2 Region: 213-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.8e-17
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 453-569
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 355-402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000108
Family EGF-type module 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001036   Gene: ENSLAFG00000001221   Transcript: ENSLAFT00000001225
Sequence length 625
Comment pep:novel supercontig:loxAfr3:scaffold_16:13880043:13914272:-1 gene:ENSLAFG00000001221 transcript:ENSLAFT00000001225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIGNINDVEFGIAFLNATVTDSPNSDTRIIHAEITNVPRSLGPAMRKIVSILNPIYWTTA
KEIGEAVNGFTLTNAVFKRETQVEFATGEILRMTHIARGLDSDGALLLDIVVSGYVLQLQ
SPADVAVKDYTEDYIQTGPGQLYAYSTRLFSIDGISVPYTWNHTISYDQARGRMPFLVET
LHASSVESDYNQLKETLGFKIHASISKGDRSNQCPSGFTLDSVGPFCADEDECAERNPCS
HTCHNAMGTYYCSCPMGLTIAVDGRTCQDIDECALSGHSCHMGQDCDNTIGSYRCVVRCG
MGFRRTSDGLSCQDIDECKDGTHQCRYNQICENTRGSYHCVCPRGYRSQGVGKPCMDINE
CEQVPKPCAHQCSNTPGSFKCTCPPGQHLLGDGKSCAGLERLPNYGNRYNSYNLAWFSPM
RNNYQPQQHYRQYSHLYSSYSEYRNSRTSLSRTRRTIRKTCPEGSEASHDTCVDIDECEN
RDVCQHECKNTFGSYQCICPPGYQLMLNGKTCQDVDECLEQNVHCGPNRMCFNLRGSYRC
INTPCPPNYQRDPVSGFCFKNCPPNDLECTLSPYALEYKLVSLPFGIAANQDLIRLVAYT
QDGVMHPRTTFVMVDEEQTVPFALR
Download sequence
Identical sequences G3SN78
ENSLAFP00000001036 ENSLAFP00000001036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]