SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001204 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001204
Domain Number 1 Region: 253-405
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-33
Family Third domain of FERM 0.0015
Further Details:      
 
Domain Number 2 Region: 143-251
Classification Level Classification E-value
Superfamily Second domain of FERM 1.11e-23
Family Second domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 57-143
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.8e-20
Family First domain of FERM 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001204
Domain Number - Region: 491-554
Classification Level Classification E-value
Superfamily Prefoldin 0.0759
Family Prefoldin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001204   Gene: ENSLAFG00000001441   Transcript: ENSLAFT00000001441
Sequence length 1034
Comment pep:novel supercontig:loxAfr3:scaffold_12:55509835:55733686:1 gene:ENSLAFG00000001441 transcript:ENSLAFT00000001441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVFMCGVEDLVFSGSRFVWNLTVSTLRRWYTERLRACHQVLRTWCGLRDVYQMTEGRH
CQVHLLDDRRLELLVQPKLLSRELLDLVASHFNLKEKEYFGITFIDDTGQQKWLQLDHRV
LDHDLPKKPGPAILYFAVRFYIESISFLKDKTTVELFFLNAKSCVHKGQIEVDSETIFKL
AALVLQEAKGDYTSDENARKDLRTLPAFPTKTLQEHPSLAYCEDRIIEHYLKIKGLTRGQ
AVVQYMKIVEALPTYGVHYYAVKDKQGIPWWLGISYKGIGQYDLQDKVKPRKLFQWKQLE
NLYFREKKFAVEVHDPRRVSVSRRTFGQSGLFVQTWYANSSLIKSIWVMAISQHQFYLDR
KQSKAKIPSARSLDDIAMDLTETGTPRVSKLVSLEAKNQFIMASNGSLISSGSQDSEVSE
EQKREKILELKKKEKLLQEKLLQKVEELKKICLREAELTGKIPKEYPLNVGEKPPQVRRR
VGTAFKLDDNLLPSEEDPALQELESNFLIQQKLVEAAKKLANEPDLCKTVKKKRKQDYTD
AVKKLQEIENAINEYRIRCGKKPSQKPAVILPEDIIPSESSSLSDTTAYDDPNDSFTLAG
QRSSSVPHSPRILPPKSLGIERIHFRKSSINEQFVDTRQSREMLSTHSSPYKTLERRPQG
GRSMPTTPVLTRNAYSSSHLEPESSSQHCRQRSGSLESQSHLLSEMDSDKPFFSLSKSQR
SSSTEILDDGSSYTSQSSTEYYCVTPVAGPYYTTQTLDTRARGRRRSKKQNVSTSNSGSM
PNLAQKDSLRNGVYSKSQEQPPSSYYIAGYTPYAECDLYYTGSYVYENDTEGQYSVNPSY
RSSAHYGYDHQRDYSRSFHEDEMDRVPHNPYATLRLPRKAAAKSEHITKNIHKALVAEHL
RGWYQRASGQKDQGHSPQTSFDSDRGSQRCLGFPGLQVPCSPSSRASSYSSVSSTNASGN
WRTQITVGVSDYEAPHSPYTSCYGNVYNPLPSPGRQYTETHQLDSTAGNRLEDSLGGSEQ
RLFWHEDSKPGTLV
Download sequence
Identical sequences G3SNK2
ENSLAFP00000001204 XP_003409841.1.64505 ENSLAFP00000001204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]