SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001378 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001378
Domain Number 1 Region: 200-320
Classification Level Classification E-value
Superfamily EF-hand 5.24e-36
Family Osteonectin 0.0097
Further Details:      
 
Domain Number 2 Region: 289-382
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.4e-29
Family Thyroglobulin type-1 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 131-183
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000101
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001378
Domain Number - Region: 396-433
Classification Level Classification E-value
Superfamily ARM repeat 0.00806
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001378   Gene: ENSLAFG00000001654   Transcript: ENSLAFT00000001654
Sequence length 436
Comment pep:novel supercontig:loxAfr3:scaffold_37:2205066:2716957:-1 gene:ENSLAFG00000001654 transcript:ENSLAFT00000001654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKLSAVLCVCAAAWCSQFLPAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNK
FRDEVEDDYFRTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHS
MKEIGVGHKQWRSPMSSACKQCPMVYTSHICGSDGHTYSSQCKLEYQACVLGKQISVKCE
GRCPCPSDKSASTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKALLRPERSR
FDTSILPICKDSLGWMFNRLDTNYDLLLDQSELGSIYLDKNEQCTKAFFNSCDTYKDSLI
SNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGLYIPLCDEDGYYKPTQCHGSVGQCW
CVDRYGNEVTGSRTNGVADCAIDFEISGDFASGDFHEWTDDEDEEDDIMNEEDEIEDDDE
DEGDDDDGGDDHDGYI
Download sequence
Identical sequences G3SNZ1
XP_003415845.1.64505 ENSLAFP00000001378 ENSLAFP00000001378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]