SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001410 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSLAFP00000001410
Domain Number - Region: 63-166
Classification Level Classification E-value
Superfamily eIF1-like 0.068
Family eIF1-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001410   Gene: ENSLAFG00000001690   Transcript: ENSLAFT00000001689
Sequence length 166
Comment pep:novel supercontig:loxAfr3:scaffold_71:4367482:4370184:-1 gene:ENSLAFG00000001690 transcript:ENSLAFT00000001689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATLFRASLWGWRTGVQPSCGLRYLSQIQGPPDYPSFVESVDEYHFVERLLPPTRIPEP
PKHKHYPTPSGWQPPKDPPPNLPYFVRRSRMHNIPVYKDITHGNRQMTMIRKVEGDIWAL
QKDVEDFLRPLLGKTPITQVNEVTGTLRVKGYFDQQLKAWLLEKGF
Download sequence
Identical sequences G3SP20
XP_003419645.1.64505 ENSLAFP00000001410 ENSLAFP00000001410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]