SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001457 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001457
Domain Number 1 Region: 515-664
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-66
Family Ankyrin repeat 0.00000178
Further Details:      
 
Domain Number 2 Region: 2-230,277-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.84e-62
Family BAR domain 0.0017
Further Details:      
 
Domain Number 3 Region: 393-510
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.89e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000491
Further Details:      
 
Domain Number 4 Region: 282-374
Classification Level Classification E-value
Superfamily PH domain-like 3.94e-20
Family Pleckstrin-homology domain (PH domain) 0.0052
Further Details:      
 
Domain Number 5 Region: 1011-1085
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001457   Gene: ENSLAFG00000001748   Transcript: ENSLAFT00000001747
Sequence length 1087
Comment pep:novel supercontig:loxAfr3:scaffold_8:75520067:75668953:-1 gene:ENSLAFG00000001748 transcript:ENSLAFT00000001747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEALDQDRTALQKVKKSVKAIYNSGQDHVQNEENYAQILDKFGSNFLSRDNPDLGTAFVK
FSTLTKELSTLLKNLLQGLSHNVIFTLDSLLKGDLKGVKGDLKKPFDKAWKDYETKFTKI
EKEKREHAKQHGMIRTEITGAEIAEEMEKERRLFQLQMCEYLIKVNEIKTKKGVDLLQNL
IKYYHAQCNFFQDGLKTADKLKQYIEKLAADLYNIKQTQDEEKKQLTALRDLIKSSLQLD
QKEVGDLCVAGGANNSRRDSQSRQGGYSMHQLQGNKEYGSEKKGYLLKKSDGLRKVWQRR
KCAVKNGMLTISHATSNRQPAKLNLLTCQVKPNAEDKKSFDLISHNRTYHFQAEDEQDYV
AWISVLTNSKEEALTMAFRGEQSTGENSLEDLTKAIIEDVQRLPGNDVCCDCGSSEPTWL
STNLGILTCIECSGIHREMGVHISRIQSLELDKLGTSELLLAKNVGNNSFNDIMEANLPS
PSPKPTPSSDMTARKEYITAKYVDHRFSRKTCSSSSAKLNELLEAIKSRDLLALIQVYAE
GVELMEPLLEPGQEIGETALHLAVRTADQTSLHLVDFLVQNCGNLDKQTALGNTVLHYCS
MYGKPECLKLLLRSKPTVDIVNQAGETALDIAKRLKATQCEDLLSQAKSGKFNPHVHVEY
EWNLRQEEMDESDDDLDDKPSPVKKERSPRPQSFCHSSSISPQDKLALPGLSTPRDRQRL
SYSAFTNQIFASTSTDSPTSPTAEAPPLPPRNAGKGPTGPPSTLPLSSQTSSGSSTLSKK
RPPPPPPGHKRTLSDPPSPLPHGPPNKGAVAWGNDVGPSSSSKTANKFEGLSQQSSTSSA
KTALGPRVLPKLPQKVALRKTETSHHLSLDKANVPPEIFQKSSQLAELPQKPPPGDLPPK
PMELAPKPQIGDLPPKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKS
QVGEVSPKVQQPSDIPQKSQPVDLSPNVQSRDTLQKQASEDSNDLTPTLPETPVPLPRKI
NTGKNKVRRVKTIYDCQADNDDELTFIEGEVIVVTGEEDQEWWIGHIEGQPERKGVFPVS
FVHILSD
Download sequence
Identical sequences G3SP57
ENSLAFP00000001457 ENSLAFP00000001457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]