SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001550 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001550
Domain Number 1 Region: 129-373
Classification Level Classification E-value
Superfamily vWA-like 9.08e-86
Family Integrin A (or I) domain 0.0000000478
Further Details:      
 
Domain Number 2 Region: 371-458
Classification Level Classification E-value
Superfamily Integrin domains 2.46e-24
Family Integrin domains 0.0003
Further Details:      
 
Domain Number 3 Region: 622-705
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-18
Family Integrin beta tail domain 0.00083
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000162
Family Plexin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 580-620
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Integrin beta EGF-like domains 0.0018
Further Details:      
 
Domain Number 6 Region: 538-576
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number 7 Region: 80-154
Classification Level Classification E-value
Superfamily Integrin domains 0.0000356
Family Integrin domains 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001550
Domain Number - Region: 505-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0109
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001550   Gene: ENSLAFG00000001853   Transcript: ENSLAFT00000001853
Sequence length 788
Comment pep:novel supercontig:loxAfr3:scaffold_3:67733256:67816141:1 gene:ENSLAFG00000001853 transcript:ENSLAFT00000001853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELFCLFLLFLGRNAYVQGGCALGGAETCAGCLLIGPHCAWCSQENFTHPSGAGERCD
TPANLLAKGCQLTFIENPVSQVEILKNKPLSVGRQKNSSNIVQITPQSLILKLRPGGEQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLSKEMSKLTSNFRLGFGSFVEK
PVSPFMKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPE
GGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDSKNE
YSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNI
LQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNSILFPHQKKCSHMKVGDTASFNVT
LSIPNCERKSRHIVIKPVGLGDTLEIHVSPECNCDCQKEVEVNSSKCHNGNGSFQCGVCA
CNPGHMGPRCECEEDTLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCD
NFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCG
KCVCTNPGASGPACERCPTCGDPCNSKRSCIECHLSADGQSQEECVDKCKLAGSTISEGE
DFSKESSVSCSLQGENDCLITFLITTDNEGKTIIHSINEKDCPKPPNIPMIILGVSLAIL
LIGFVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKHREKQ
KVDLFTDG
Download sequence
Identical sequences G3SPD2
XP_003406050.1.64505 ENSLAFP00000001550 ENSLAFP00000001550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]