SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001583 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001583
Domain Number 1 Region: 1455-1560
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 2 Region: 560-666
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000791
Further Details:      
 
Domain Number 3 Region: 700-804
Classification Level Classification E-value
Superfamily SRCR-like 3.92e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000709
Further Details:      
 
Domain Number 4 Region: 293-397
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 429-533
Classification Level Classification E-value
Superfamily SRCR-like 1.31e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00018
Further Details:      
 
Domain Number 6 Region: 153-255
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00024
Further Details:      
 
Domain Number 7 Region: 5-111
Classification Level Classification E-value
Superfamily SRCR-like 6.93e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00026
Further Details:      
 
Domain Number 8 Region: 1340-1446
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 9 Region: 1100-1212
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 10 Region: 982-1091
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-29
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 11 Region: 846-885
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000405
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001583   Gene: ENSLAFG00000001892   Transcript: ENSLAFT00000001892
Sequence length 1958
Comment pep:novel supercontig:loxAfr3:scaffold_72:491890:565953:1 gene:ENSLAFG00000001892 transcript:ENSLAFT00000001892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEAWPALKLVNGRGRCSGGVEVSYQGTWGSVCDDGWGLKEAQVVGRQLGCGQVVSGPHGA
HFSPSFGKILLDNVQCSGEEQHLALCAHNTWFTHNCGHEEDAGAICLGSPTASPSPPGHS
RSASKSCLSVAAEITTAPTTSVEDQAPTGTEAWMEVRLVNGTGRCSGRVEVLVQSTWRTV
CDDLWDLAEATVVCHQLQCGQAVEAPIGAHFGAGAGQILLDNMQCVGSESHLGQCVHRGQ
AELNCGQLEDAGVVCEVTAGTCLSVEAFMWLPGGVDQSYLGSVSPLCACPGAWMEVKLVN
GTGRCSGRVEVLIQGTWGTVCDDLWDLAEATVVCRQLQCGQAMEAPMGAYFGAGSGQILL
DDLQCEGSESHLGQCVHRGQAGLNCGHLEDAGVVCEENPTGADDPPGHTPTTEPEVATPW
YTPWATGAWMEVRLVNGTGRCSGRVEVLVQGTWGTVCDDLWDLAEATIVCHQLQCGQPVE
APTGAHFGAGVGQILLDDVQCVGSESHLGQCVHRGQAELNCGHLENAGIVCEGADDSPGP
TPTTEREAATPPYTPSATRGWAPVRLVGGRGSCSGRVELFYQGVWGTMCDDMWDLQEANI
VCRQLGCGWAISAPGEAHFGEGSGKILLDNVHCTGEEQHLEECSHIGWFSHNCGHSEDAS
VICSGAEYSTVTPPVFFVLDQLSTAIPTGTPKTVTARPGDWPELRLVGGPGQCSGRVEVL
HQGAWGTVCDDLWDLNEAEVVCRQLECGRAVSALGKAHFGPGSGDIFLDDLQCAGVERYL
GQCAHSGWSEHNCGHHEDAGVICSVTQSKSPQAPPFYYSLQSILLFSFTAQTTMWDSCIT
SLSTGDWPELRLVGGSGQCSGRVEVLHQGAWGTVCDDLWDLNDAESSVTPADAVCRLSLG
PSSGNLPLRPLVSDVMWRGFATIRPGWHSDAEDLPLPTSPDSFTTPIHWPQLRKVQQQPL
MLLTGKTWNLWNSVSITRGSSSCGGVISSLSGSFSSPQYPESYPTDVQCVWEIHVDKKFH
IELMIPSLKLEDILGCPYDSVEIFNGPRIASLSMGKFCAPVTVIFFSSSNIMTVVFRSDS
MITNIGFTTHWLKTIRGSKSCGGVISSLSGSFSSPWYPTNYPTDVECVWVIHVADTFHIE
LTIPSLKLEDIYGCPYDYVEVFDGRQVASLSVGRFCAGAELTFLSSSNIMTAVFRSDAMI
TNTGFYALYQAVQVNIVVPVKCPRSHLNSCDELCDCLTQSISHLSLNRCRWELQSRTNRY
RFSIHFNELPGPWCFFFFFLVCMSPGYSLIPKLGYSRIKFYVTRGMLSLPFLYEKLQHGR
AFDKFYRFLADENFHCGGLLTNNSGSFSSPWYPKKYPTNMVCAWDIQVDTRAHVKLSFEV
LKMENFYGCPYDFIEVFDGPQSEPLSLGRFCASTTPIFTSSSNRMTVVFHSDAIITNIGF
YASYESLMQDENDTDVALRLSNGSHPCEGRVELHYNGSWGTVCDDSWDLRDAQVVCRQLG
CGRAVSALGWAHFSRGLGAIALDDVECMGNEARLWQCLHSGWFSHNCGHHEDASVVCSAP
SVAPPKVSPGVWVVQPCVVIYTSSAEVTSPSGKDSHIVLFNVANFFCNVFCLPNFLNMIN
FPSFYVTTTLVAFQETPAQKGLTHQGVEIIKKIHHHLPNFDANFDYKYATLSTTTKSLSL
FYSYDFSWCRNGPFTWHYHYSISVNSTQLSCLPHLFQAIIDRGYLRRLGYSSWDLHLNDK
LCRPQVSGHYLIFNIPYGHCGTVWQESLGSFSYSNSIRGRILGHPGRVIVRHKVPQLKLT
CRVDRPSAGAVVHGADIPSEGVGYDVSITFLKSPSSHHMGGMKPHYTSQRQEVFLQAILH
SHDPNLMLFVDTCVASPDPQDFTTAKYELIKQGCIKDNTYANLHSRQKNVAQFKFNAFSF
LNSYDVVYLQCKIAVCLVGDYSSRCAHGCVGQSKTGAG
Download sequence
Identical sequences G3SPF7
ENSLAFP00000001583 ENSLAFP00000001583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]