SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001586 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001586
Domain Number 1 Region: 159-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 2 Region: 53-145
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-17
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001586   Gene: ENSLAFG00000001895   Transcript: ENSLAFT00000001896
Sequence length 608
Comment pep:novel supercontig:loxAfr3:scaffold_72:568808:581294:-1 gene:ENSLAFG00000001895 transcript:ENSLAFT00000001896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVRRLILLAVLVTSYLAELSLTESEGKSNCTASLGGTSMSEVHNAMILQLNPDENCTW
TIERPENKSVRIIFSYVQLDPDGSCESENIKVFDRTSTAGPLLGEVCSKNDFVPVFESSS
NTLTFQIITDSTVIQRSVFLFYYFFSSGTSIPDCGGYLDAFEGSFTSPNYPKPHPELAYC
VWHIHVEKGYKIKLEFKEIFLETDAYCRFDFIAVYDGSSTDSGLIAQVCGLTKPTFESSS
DSLTVVLSTDYANSYRGFSASYTSVYAEEVNTTSLTCFSDKMRVILSKSYLESFNYNENN
LQLIDPTCRPKVSNVVEFSIPLDGCGTIKKAEDHSITYTNIVTLTPLSTSAVITHQKRLQ
IIVKCEMENNSTLEIMYVTEDDIIQNQNALGKYNTSLAFFESNSFEKPVVESPYYVFLNQ
TVFVQASLHTSDPNLVVFLDTCLASPTSDLASPTYDLIRSGCSEDETCKVYPLSGHYGRF
QFNAFKFLRSLTSVYLQCKILICDSNDPQSRCNQGCVSRRKRDISSYKWKTDSIIGPIRL
KRDRGASGNSEALRFQLPAEESPNQPFNSLHLFSFMALVLNVVIVGAVIVRHYVNRRTAY
KYQKLQNY
Download sequence
Identical sequences G3SPG0
ENSLAFP00000001586 ENSLAFP00000001586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]