SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001713 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001713
Domain Number 1 Region: 176-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000982
Family LDL receptor-like module 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001713
Domain Number - Region: 72-168
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000209
Family Spermadhesin, CUB domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001713   Gene: ENSLAFG00000002049   Transcript: ENSLAFT00000002048
Sequence length 287
Comment pep:novel supercontig:loxAfr3:scaffold_26:254573:270465:-1 gene:ENSLAFG00000002049 transcript:ENSLAFT00000002048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVYLLQLPQRLLLLGAAAVTTSALETADLVNLCRQKWQGDGLLLCSHPASRKFYFMAQD
TDRGLWWWAEAPSNRVRFQLCFFLVYSMIPAFPVPLESLASNTSCPEWDPGAPGSYLQFY
KGPSGVPWPLGPPVCGLTIPAPVASSGPSMGLRLVTRGCQPRVNFVGEVTSFWLGFCGGY
FRRWNGRCIPPSLVCDRWDIDNCGDGSDRASQPPASCRVPPSLIHTLSPLPSLPPGSQRD
AAATRGSSITSSPALGSAGPLRTAAERTTPAGQDPALQGAASKGRQM
Download sequence
Identical sequences G3SPQ4
ENSLAFP00000001713 ENSLAFP00000001713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]