SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001716 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001716
Domain Number 1 Region: 3154-3345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-39
Family Laminin G-like module 0.00048
Further Details:      
 
Domain Number 2 Region: 3408-3610
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-38
Family Laminin G-like module 0.00075
Further Details:      
 
Domain Number 3 Region: 1615-1631,2912-3092
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-33
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 381-464
Classification Level Classification E-value
Superfamily Immunoglobulin 6.1e-20
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 2820-2907
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 2456-2550
Classification Level Classification E-value
Superfamily Immunoglobulin 3.06e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 7 Region: 2358-2447
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 2742-2829
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 9 Region: 2069-2138,2192-2255
Classification Level Classification E-value
Superfamily Immunoglobulin 1.43e-18
Family I set domains 0.034
Further Details:      
 
Domain Number 10 Region: 2543-2629
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 1648-1736
Classification Level Classification E-value
Superfamily Immunoglobulin 4.39e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 2268-2363
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-16
Family I set domains 0.027
Further Details:      
 
Domain Number 13 Region: 1974-2058
Classification Level Classification E-value
Superfamily Immunoglobulin 5.71e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 14 Region: 1784-1881
Classification Level Classification E-value
Superfamily Immunoglobulin 6.33e-16
Family I set domains 0.036
Further Details:      
 
Domain Number 15 Region: 1878-1962
Classification Level Classification E-value
Superfamily Immunoglobulin 9.37e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 16 Region: 2647-2738
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.023
Further Details:      
 
Domain Number 17 Region: 300-336
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000497
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 18 Region: 343-385
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000109
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 19 Region: 1537-1589
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 20 Region: 734-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000193
Family Laminin-type module 0.0052
Further Details:      
 
Domain Number 21 Region: 259-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 22 Region: 1131-1183
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000391
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 23 Region: 794-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 24 Region: 174-213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 25 Region: 3350-3393
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.01
Further Details:      
 
Domain Number 26 Region: 1596-1644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family Laminin-type module 0.061
Further Details:      
 
Domain Number 27 Region: 1191-1236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000193
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 28 Region: 3090-3123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000461
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000001716
Domain Number - Region: 857-896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 1502-1539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00595
Family Integrin beta EGF-like domains 0.061
Further Details:      
 
Domain Number - Region: 1094-1133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00648
Family Laminin-type module 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001716   Gene: ENSLAFG00000002050   Transcript: ENSLAFT00000002051
Sequence length 3636
Comment pep:novel supercontig:loxAfr3:scaffold_26:178896:252851:1 gene:ENSLAFG00000002050 transcript:ENSLAFT00000002051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTHGLRAYDGLSLPEDAETVTVGRAGWSYLDLSDDEDLLADSASGGEVSRGWEWRADGQR
VYFRALVNFTHSIDYSPQLEDAGSEEFREVSEAVVDTLESEYLKIPGDQVVSVVFIKELD
GWVFVELDVGSEGNADGAQIQNVLHSVISSGSIASYITSPQGFQFRRLGTVPQFSRACTE
AEFACHSHNECVALEYRCDRRPDCRDMSDELNCEELVPSSVLPSLVETPPLPPQPEASIV
QRPPDILAPQPLPDEGTPGPCGSHEAACHSGHCIPKDYLCDGQEDCKDGSDELDCGPTPP
CEPNEFACGNGHCAFKLWRCDGDFDCEDRTDEANCPAKRPEDVCGPTEFRCVSTNTCIPA
SFHCDEESDCPDRSDEFGCMPPQVVTLPQELIQASRGQTVTFTCVAIGVPTPIINWRLNW
GHIPLHPRVTMTSEGGRGTLTIRDVKEADQGAYTCEAMNARGMVLGVPDGVLELIPQRGP
CPDGHFYLEDSASCLPCFCFGITNVCQSSRRFWDQIRLRFDQPDDFKGVNVTMPTQPGVQ
PLSSTQLQIDIALQEFQLVDLSRRFLVHDSFWALPKQFLGNKVDSYGGSLRYKVRYELAR
GTLEPVQRPDVVLVGAGYRLLSRGHTPTQPGAVNQRQVQFSEEHWVHESGRPVQRAEPRP
QRGGVQVPDLAGLGNTGTPARIRGKEQGLRVPAATLLVLPPRCPIGYSGLSCESCDTHFT
RVPGGPYLGTCSGCNCNGHASSCDPVYGHCLNCQHNTEGPQCNKCKTGFFGDATKATATA
CRPCPCPYIDASRRFSDTCFLDTDGQATCDACAPGYTGRRCESCAPGYEGNPIQPGGKCR
PVTQQIVRCDERGSMGTSGEACRCKNNVVGRLCNECADGSFNLNARNPDGCLKCFCMGVS
RQCTSSSWSRAQVHGASEEPTQFSLTNAAGTHTTSDGISSPTPGELVFSSFHSLLSGPYF
WNLPPRFRGDKVTSYGGELRFTVTQRPQPGSVPLHGQPLVVLQGNNIVLEHHVSQEPSPG
QPSTFTVPFWERAWQRPDGQPVTREHLLMALAGIDTLLIQASYTQRPAETRPRISGISMD
VAVPEDTGQDPALEVEQCACPPGYRGPSCQDCDTGYTRTSSGLYLGTCERCSCHGHTEIC
EPETGACQGCQHHTEGPQCEQCQPGYYGDAQRGTPQDCQPCPCHGAPAAGQATHTCFLDT
DGHPTCDACSPGHSGRHCERCAPGYYGNPSQGQPCQRDSQLPQPVPCDCDPQGSVSSQCD
AAGQCQCKLPPEGSSLPRCMGSGGNQAASDGSGVLDMGWAATPQNCFSSFTYSQFIRPHC
WPSTFRPSSTINPLCAHVPLRGPGVNPVYKPRKFSLSYEGFSLLPERLFYWQLPRAFLGD
KVAAYGGKLHYTLSYTAGAQGSPLSDPDVQITGNNIMLVASQPALQGSERKSYEIVFREE
FWRRPDGQPATREHLLMALADLDELLVRATFSSVPLAASISAVSLEVAQPGPSNGPRALE
VEECRCPPGYIGSSCQDCAPGYTRTGSGLYLGHCELCECNGHSDLCHPETGACSQCQHNA
SGEFCEQCVPGYYGDATAGTPEDCQPCACPLTNPENMFSRTCESLGAGGYRCTACEPGYT
GQYCEQCAPGYVGNPNVRGGRCVPQDQAPLVVQVHPARSIVPQGGSHSLRCQVSGNPPHY
FYWSREDGRPVPSSTQQRHQGSELHFPSVQPSDAGVYICTCRNHYHANTSRAELLVTGES
LAPSSPSVPKNTYPDLGCRLHQTTLPTLTMYSSLPLSASGAPSAPVVSIHPPQLTVQPGQ
LAEFRCSATGNPTPTLEWTGGPGGQLPQKAQIHGGILRLPAVESSDQAQYLCRAHSSAGQ
HVARAMLHVHGGSGPRVQVSPERQVHEGRTVSLYCRAAGVPSARVTWHKRGGSLPARHQT
HGSRLRLHHMSVADSGEYVCRANNNIDAQEASIVVSVSPSTSVPSASGGTQPIRIESSSS
HVAEGQTLDLNCVVPGQAHAQVTWHKRGGSLPTHHRTHGSRLRLHQVSPADSGEYVCRVM
GSSGPVEASVLVTIEASGSSAVHIPASGGAPPIRIETSSSRVAEGQTLDLNCVVPGQAHA
QVTWRKRGGSLPARHQVRSWRRHLPECSPEADSGEYSCSDSSSAPGASVWSQLRTLPLSP
TPVPTAPGLAQPIYVEASSSHVTEGQTLDLNCVVPGQAHAQVTWHKRGGSLPARHQTHGS
RLRLHHISPADSGEYVCRVVGGSGPEQEASFTVTVPPSTGSSYRLRSPVISIDPPSSTVQ
QGQDASFKCLIHDGAAPIRLEWKTRNQELEDNIHISPNGSVITIMGTRPSNHGAYRCVAS
NAYGVAQSVVNLSVHGPPSVSVLPEGPVRVKVGKSVTLECVSTGEPHSSARWTRIGTPHK
LEQRMHGHVDSHTVLQISSAKPSDAGTYVCLAQNALGMAQKQVEVIVDMGTVAPGAPKVQ
VEEVELTVEAGHTATLRCSATGSPTPTIHWSKLRSPLPWQHRLEGNTLIIPRVAQQDSGQ
YICNATSPAGHAEATIVLHVDSPPYATTIPEHASVQAGETVQLQCLAHGTPPLTFQWSRV
GGSLPRRAVARNELLHFQPTAPEDSGRYRCQVTNRVGLAEAFAQLTVQGSAPTGILPNTS
IPARSSPTVQVTPQLETKSIGSSVEFHCAVPSDQGTQLHWFKEGGQLPPGHSVQDGVLRI
QNLDQSCQGTYVCQAHGPWGQAQASAQLVVQALPSVLINIRTSVQTVVVGHTVEFECLAL
GDPKPQVTWSKVGGHLRPGVVQSGGVIRIAHVELADAGQYRCTATNAAGTTQSHVLLLVQ
ALPQISTPPEVRVPAGSAAVFPCMVSGYPTPDITWSKLDGNLPPDSRLENNMLMLPSVRP
QDAGTYVCTATNRQGKVKAFAHLQVPERVVPYFTQTPHSFLPLPTIKDAYRKFEIKITFR
PDSADGMLLYNGQKRTPGSPTSLAHRQPDFISFGLVGGRPEFRFDAGSGMATIRHPTPLA
LGQFHTVTLLRSLTQGSLVVGNLAPVNGTSQGKFQGLDLNEELYLGGYPDYSAIAKAGLS
SGFVGCVRELRIQGEEIVFHDLNLTAHGISHCPTCRDRPCQNGGQCHDSESSSYVCVCPA
GFTAAVSTHRPCTATQACGPDATCVNRPDGRGYTCRCHLGRSGLKCEEGVTVTTPSMSGT
GSYLALPALTNTHHELRLDIEFKPLTPDGILLFSGGKSGPVEDFVSLAMVGGHLEFRYEL
GSGLAVLRSAEPLALGRWHRVSAERVNKDGSLRVNGGRPVLRSSPGKSQGLNLNTLLYLG
GVEPSVQLPLATNISTHFHGCVGEVSVNGKRLDLTYSFLGSQGIGQCYDSSPCERQPCQN
GATCMPAGEYEFQCLCQDGFKGDLCEHEENPCQLDEPCLHGGTCKGTQCLCAPGFSGPRC
QQGSGHGTAESDWHLEGSGGNDAPGQYGAYFHDGGFLALPGRSFSRGLPEAPETIELEVR
TSTANGLLLWQGVMVGETSQGKDFISLGLQDGQLVFSYQLGSGEARLVSEDPINDGEWHR
VTVLREGRRGSIQVDGEELVSGQSPGPNVAVNTKGSIYIGGAPNVATLTGGRFSAGITGC
IKNLVLHSAWPGAPPPQPLDLQHRAQAGANTRPCLS
Download sequence
Identical sequences G3SPQ7
ENSLAFP00000001716 ENSLAFP00000001716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]