SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001739 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001739
Domain Number 1 Region: 166-279
Classification Level Classification E-value
Superfamily C-type lectin-like 5.67e-28
Family C-type lectin domain 0.00000359
Further Details:      
 
Domain Number 2 Region: 135-159
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000144
Family Triple coiled coil domain of C-type lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001739   Gene: ENSLAFG00000002080   Transcript: ENSLAFT00000002080
Sequence length 279
Comment pep:novel supercontig:loxAfr3:scaffold_63:1759302:1761944:-1 gene:ENSLAFG00000002080 transcript:ENSLAFT00000002080 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGHVPPPNSLGGTGQECPQGREVCMGSPGIPGIPGLHGQPGRDGKDGIKGDPGPPGTRLE
RSPSTEVSKGQLSGGTCAQGTAGPMGPPGGMAGIPGRDGLTGATGVAGECGDKREPREWG
PPGEKHWVGLPASLDEELQSTLHDFRHQILQLMGVLSLQRFMLAVGEKVFSTNGQSVNFD
AIRESCARAGGRIAVPRSPEENTAIASIVKEHSTYAYLGLAEGSTPGEFYYLDGAPVNYT
NWYLGEPRGLGKERCVEMYTDGQWNDKNCLQHRLTICEF
Download sequence
Identical sequences G3SPS6
ENSLAFP00000001739 ENSLAFP00000001739

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]