SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001788 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001788
Domain Number 1 Region: 151-346
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.35e-59
Family Astacin 0.0000596
Further Details:      
 
Domain Number 2 Region: 778-885
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-38
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 3 Region: 467-572
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-36
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 4 Region: 353-462
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-36
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 5 Region: 618-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-35
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 6 Region: 909-1002
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-27
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 7 Region: 726-770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000639
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 8 Region: 574-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001788   Gene: ENSLAFG00000002137   Transcript: ENSLAFT00000002137
Sequence length 1012
Comment pep:novel supercontig:loxAfr3:scaffold_37:1254952:1504916:1 gene:ENSLAFG00000002137 transcript:ENSLAFT00000002137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGTLSPRMLVWLVASGIVFYGELWVCVGLDYDYTFDGNEEDKTETIDYKDPCKAAVFW
GDIALEDEDLNIFQIDRTIDLTQNPFGRLGHTTGGLGDHGMSKKRGALYQLIDRIRRIGS
GLQQNKTVKGKVPLKFSGQNEKNRVPRAATSRTERIWPGGVIPYVIGGNFTGSQRAMFKQ
AMRHWEKHTCVTFIERSDEESYIVFTYRPCGCCSYVGRRGNGPQAISIGKNCDKFGIVVH
ELGHVIGFWHEHTRPDRDNHVTIIRENIQPVQEYNFLKMESGEVNSLGERYDFDSIMHYA
RNTFSRGMFLDTILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESNGNL
SSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL
GRFCGDKLPDVLTSTDSRLWVEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPD
DYRPMKECVWKITVSEDYYVGLNFQAFEIERHDNCAYDYLEVRDGTSENSPLIGRFCGYD
KPEDIRSTANTLWMKFVSDGTVNKAGFAATFFKEEDECAKPDRGGCEQRCLNTLGSYQCA
CEPGYELGPDKRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCIWQVVAPTQYRISVKF
EFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSK
KGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHENKHDCKEAECEQKIHS
PNGIITSPNWPDKYPSRKECTWEISATPGHRVKLAFSEFEIEQHQECAYDHLEVFDGETE
KSPILGRLCGNKIPEPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDL
YSHAQFGDNNYPGQVDCEWLLVSEQGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAV
GLGHFCGSGPPEEIYSTGDAVLIRFHTDDTINKKGFHIRYKSIRYPDTMHTK
Download sequence
Identical sequences G3SPW8
ENSLAFP00000001788 ENSLAFP00000001788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]