SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001795 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001795
Domain Number 1 Region: 30-164
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-43
Family C-type lectin domain 0.00000094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001795   Gene: ENSLAFG00000002146   Transcript: ENSLAFT00000002146
Sequence length 166
Comment pep:novel supercontig:loxAfr3:scaffold_27:31563465:31566119:-1 gene:ENSLAFG00000002146 transcript:ENSLAFT00000002146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACPNSCLILSMCLMFLSLSQGKEAQMEKSSVRISCPEGANAYGSYCYYFNEDRETWTDA
DLFCQNMHSGHLVSMINQAEATFVASLIKESRADDPYVWVGLHDPKKNRRWHWSSGSLVS
YKAWAIGAPSKANPGYCVSLTSNSGFQKWKDENCDAQFSFVCKFKN
Download sequence
Identical sequences G3SPX5
ENSLAFP00000001795 XP_003413754.1.64505 ENSLAFP00000001795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]