SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001866 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001866
Domain Number 1 Region: 3-73
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.0000000000102
Family Pyk2-associated protein beta ARF-GAP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001866   Gene: ENSLAFG00000002232   Transcript: ENSLAFT00000002234
Sequence length 510
Comment pep:novel supercontig:loxAfr3:scaffold_55:11215937:11279056:-1 gene:ENSLAFG00000002232 transcript:ENSLAFT00000002234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEF
LQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPALHLSKG
TPSQSPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHTAQNSA
NADFANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAGSVNANFAHFDNFPKSSSADF
GTFNTSQSHQTASAVSKVSANKSGLQTADKYAALANLDNIFSAGQGGDQGSGFGTAGKAP
AASVVSVPSQPSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSSVFGTVPVGASAQT
QPASSSVPAPFGATPSTNPFVAAAAAAAGPSVASSTNPFQTNARGATAATFGTASMSMPA
GFGTPAPYSLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQV
AAAGVSSNPFMTGAPTGQFPAGSSSTNPFL
Download sequence
Identical sequences G3SQ28
ENSLAFP00000001866 ENSLAFP00000001866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]