SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000001867 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000001867
Domain Number 1 Region: 31-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-38
Family SPRY domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000001867   Gene: ENSLAFG00000002235   Transcript: ENSLAFT00000002235
Sequence length 207
Comment pep:novel supercontig:loxAfr3:scaffold_2:45800971:45801966:1 gene:ENSLAFG00000002235 transcript:ENSLAFT00000002235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPFARSLSLCRWGAKRLGIAAAEARRGISFKLEEKTAHSSLALFKGDTGVKYGMVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDISRDSCIGVDDR
SWVFTYAQRKWHTMLVKEKTPIEGIGQPEKVGLLLDYEAQKLSLVDVSRVAVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences G3SQ29
ENSLAFP00000001867 XP_003405180.1.64505 ENSLAFP00000001867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]