SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002060 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002060
Domain Number 1 Region: 494-659
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.12e-71
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 759-894
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.94e-53
Family I/LWEQ domain 0.00000024
Further Details:      
 
Domain Number 3 Region: 2301-2492
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.38e-51
Family I/LWEQ domain 0.00011
Further Details:      
 
Domain Number 4 Region: 664-788
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.84e-48
Family I/LWEQ domain 0.000000521
Further Details:      
 
Domain Number 5 Region: 1847-1979
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.83e-46
Family VBS domain 0.000000488
Further Details:      
 
Domain Number 6 Region: 1231-1367
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 2.04e-38
Family VBS domain 0.014
Further Details:      
 
Domain Number 7 Region: 204-314
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-27
Family Second domain of FERM 0.00000161
Further Details:      
 
Domain Number 8 Region: 1081-1213
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.07e-26
Family VBS domain 0.029
Further Details:      
 
Domain Number 9 Region: 315-405
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-25
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 10 Region: 1416-1561
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000000000000562
Family I/LWEQ domain 0.0076
Further Details:      
 
Domain Number 11 Region: 88-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000183
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 12 Region: 1701-1820
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000298
Family VBS domain 0.027
Further Details:      
 
Domain Number 13 Region: 2016-2138
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000011
Family VBS domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSLAFP00000002060
Domain Number - Region: 955-1048
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000667
Family I/LWEQ domain 0.0041
Further Details:      
 
Domain Number - Region: 1604-1664
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00314
Family VBS domain 0.072
Further Details:      
 
Domain Number - Region: 2106-2233
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0523
Family I/LWEQ domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002060   Gene: ENSLAFG00000002460   Transcript: ENSLAFT00000002463
Sequence length 2547
Comment pep:novel supercontig:loxAfr3:scaffold_6:64635739:64660194:1 gene:ENSLAFG00000002460 transcript:ENSLAFT00000002463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGWKEEAATMVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEALAGPPSDFGLFL
SDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDM
LMTICARIGITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDEL
NWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVS
FDKACEFAGFQCQIQFGPHNEQKHKAGFLEFFEKFYYSSQRETKVFGAHKNCGQMSEIEA
KVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLT
NIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGD
EESTMLEDSVSPKKSTVLQQQYNRIGKVEHGSVALPAIMRSGASGPENFQMGSMPPAQQQ
ITSGQMHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKN
KMDESKHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLL
AALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQ
IGESDTDPHFQDMLMQLAKAVASAAAALVLKAKSVAQRTEDAGLQTQVIAAATQCALSTS
QLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAV
TQALNELLQHVRAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATS
DLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAA
EGLRMATNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKVSAGPQPLLVQ
SCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQ
ASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDG
KLKPLPGETMEKCVQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRALAQA
ARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQ
ALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAAT
ELVQASRGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSKEDRAQVVSNLKGISMSSSK
LLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVR
ELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGEAIATASKALC
GFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSA
ATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEEN
RAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLI
QTARALAVNPRDPPRWSVLASHSRTVSDSIKKLITSMRDKAPGQLECESAITALNSCLRD
LDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLAGAARAEASQLGHKVSQM
AQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQE
ALEEAVQMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQ
TTMVRTAKAIAVTVQEMVTKSNTNPEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGS
HIKHRVQELGHGCSALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRG
TQACITAASAVSGIIADLDTTIMFATAGTLNREGAETFADHREGILKTAKVLVEDTKVLV
QNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDL
ISATKAAAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIR
QELAVFCSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIAD
MLRACKEAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSK
RVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKE
ADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLI
SAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMK
RLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERE
LEEARKKLAQIRQQQYKFLPSELRDEH
Download sequence
Identical sequences G3SQH8
ENSLAFP00000002060 ENSLAFP00000002060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]