SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002150 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002150
Domain Number 1 Region: 317-422
Classification Level Classification E-value
Superfamily Second domain of FERM 3.01e-35
Family Second domain of FERM 0.00000103
Further Details:      
 
Domain Number 2 Region: 421-564
Classification Level Classification E-value
Superfamily PH domain-like 1.32e-34
Family Third domain of FERM 0.00000592
Further Details:      
 
Domain Number 3 Region: 236-316
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.96e-26
Family First domain of FERM 0.00000875
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002150   Gene: ENSLAFG00000002571   Transcript: ENSLAFT00000002573
Sequence length 858
Comment pep:novel supercontig:loxAfr3:scaffold_34:7116014:7237018:1 gene:ENSLAFG00000002571 transcript:ENSLAFT00000002573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEKSLVAEAENSQHQQQKEEGEGATNSGQQETQLEEASQTAAEGDNQCEQKLKTSNGD
TPTHEDLTKNNDRTSESRGFSRLFSSFLKRPKSQVSEEEGKEIESAKEKSEGGQKEIEFG
ASLDDEIILKAPIAAPEPELKTDPSLDLHSLSSAETQVDYMRYFSFKNIWHLESNMKLWS
CYPAQEERREDPDFETKEGGGLEECCNIEVKEESPESKAERELKASQKSIRRQRNMHCKV
SLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLAFWDNATSKTWLDAAKEIRKQ
IRGVPWNFTFNVKFYPPDPTQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQ
SELGDYDRELHGADYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLS
MYGVDLHKAKDLEGVDIILGVCSSTFWLYKDKLRINRFPWRKVLKVSYKRSSFFIKIRPG
EQEQYESTIGFKLPSYRAAKKLWKVCVEHHTFFRLTSTDTVPKTKFLALGSKFRYSGRTQ
AQTRQASALIDRPAPHFERTASKRASRSLDGAPTLDSTDRSPRPISAPAIAEGQIPEGTV
PGSQEKTEEMPEQVEPEPTEVWKAEKTHIKVTVPTSNGDQTQKKRERLDGENIYIRHSNL
MLEDLDKNQEEIKKHHASISELKKNFMESVPEPRPSEWDKRLSTHSPFRTLNINGQVPTG
EGPPLVKTQTVTISDSANAVKSEIPTKDVPIVHTETKTITYEAAQTDDSNGDLDPGVLLT
AQTITSETTSGTTTTQITKTVKGGISETRIEKRIVITGDTDIDHDQVLVQAIKEAKEQHP
DMSVTKVVVHQETEIAEE
Download sequence
Identical sequences G3U5U6
ENSLAFP00000002150 ENSLAFP00000023204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]