SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002160 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002160
Domain Number 1 Region: 152-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000134
Family Ras-binding domain, RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002160   Gene: ENSLAFG00000002583   Transcript: ENSLAFT00000002583
Sequence length 286
Comment pep:novel supercontig:loxAfr3:scaffold_30:24050149:24065172:1 gene:ENSLAFG00000002583 transcript:ENSLAFT00000002583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDGQLIVEGMLDIFWGVKRPIQLKIQDEKEFNLWPQPRETRYHLEKCQLNGSGRSLKKTL
TKPGLETGVFCCGWQGDYLSYHSSTLKPHAVEELESPLLYRTMSEATLVRKRIRPPPMDR
KDRQNHRASINGHVYNYETSIFTPAYESETKVRINSNMRTEEVIKQLLQKFKIENSPQDF
ALYIIFSTGERRRLKETDIPLLQRLLQGPSKEHARIFLMDKDVEEISSDVAQYINFHFSI
LESILQRINEEEKREIQRTITKFTTEKAIILKYLKSKRVVRTETTV
Download sequence
Identical sequences G3SQR8
ENSLAFP00000002160 ENSLAFP00000002160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]