SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002184 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002184
Domain Number 1 Region: 62-189
Classification Level Classification E-value
Superfamily C-type lectin-like 9.27e-34
Family C-type lectin domain 0.00000861
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002184   Gene: ENSLAFG00000002613   Transcript: ENSLAFT00000002613
Sequence length 192
Comment pep:novel supercontig:loxAfr3:scaffold_193:74508:79340:1 gene:ENSLAFG00000002613 transcript:ENSLAFT00000002613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
STAFQNNLWNLISGALAVVCLLLMATLGILLKNSFATENIQPILSPGFTLEPKLGKYDKM
LSSFKFLGSGCCPCQEKWIGYRCNCYFFSNEEKTWAESRDFCASHNSSLLQLESKDEFSF
RISSGLYYWIGLTYNERRGAWLWEDGSALSRDLFPLFQTLNRQNCIVYKPSGSILDEDCR
ERFPFICRHQLF
Download sequence
Identical sequences G3SQU2
ENSLAFP00000002184 ENSLAFP00000002189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]