SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSLAFP00000002275 from Loxodonta africana 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSLAFP00000002275
Domain Number 1 Region: 3126-3284
Classification Level Classification E-value
Superfamily C-type lectin-like 3.5e-41
Family C-type lectin domain 0.00000421
Further Details:      
 
Domain Number 2 Region: 148-258
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-38
Family Link domain 0.0026
Further Details:      
 
Domain Number 3 Region: 253-354
Classification Level Classification E-value
Superfamily C-type lectin-like 7.63e-30
Family Link domain 0.0024
Further Details:      
 
Domain Number 4 Region: 32-149
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000825
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 5 Region: 3285-3343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000125
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 6 Region: 3082-3123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000179
Family EGF-type module 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSLAFP00000002275   Gene: ENSLAFG00000002716   Transcript: ENSLAFT00000002717
Sequence length 3387
Comment pep:novel supercontig:loxAfr3:scaffold_7:87344788:87449381:1 gene:ENSLAFG00000002716 transcript:ENSLAFT00000002717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVNIKSILWMFSTLIATHALHKVDVEKNLPVKGSLSGKVSLPCHFSTMPTLPPSYNTTS
EFLRIKWSKIEVDKNGKDLKETTVLVAQNGNIKIGQGYKGRVSVPTHPEDVGDASLTMVK
LRASDAGLYRCDVMYGIEDTQDTVLLTVDGVVFHYRAATSRYTLNFEAAKKTCLDIGAVI
ANPEQLNAAYEDGFEQCDAGWLSDQTVRYPIRTPREGCYGDMMGKEGVRTYGFRSPLETY
DVYCYVGLLDGDVYHITAPNKFTFEEAKEECENQDTRLATVGELHAAWRNGFDQCDYGWL
SDGSVRHPVTVARVQCGGGLLGVRTLYRFENQTGFPPPDSRFDAYCFKPKQNVSEATTIE
LNILAETASPSLSKKPQIVPDRTTPIMPLITELPVITTKFSPVENIAQFEQKILVQSQTV
TDRLATESPTPSGSTRKPWDTDYQPSASGPLEKPDISEIKEEVPKSTTIISHHTTDSWDD
ITEDTQTQESVTQIEQIEVGPLVTSVEISKHTSSKEFSVSEIPFLSMRMTMESRIEKKTV
STISESATTNLYGFTSGNGDGEDRTLTVRPGHSTLVFSQIPEIITVSKTSEDTAHTQVEE
SKSISASTIITSVTLPDNDGSSMGNREEKQTTGRITEDFVGQHVSTTPFPPQLQTKVESF
PFSGDKMLTEEIPTVIYAFPQTKMTQGRERIETQRPEMRTDTYTNDEIQAKITKDPFIGK
TEEEFSGMEISTVSSEPSVEITKSSESSALTTTKASVQPTEERDIEEEFGTTPMGLETDG
DQDTTKYDEGVTTVHLTHSTLNVEVVTVSKWSWDEDNTTSKPLESTEHEGSPKLPPVLLT
TVGGNGKDEEIPRFTDHGDEFTLIPDSTQKPLEEITEEYITDHGKFTVRLQPTTSISIAE
RSTLRDSTTEERVPSISRTEGKVVYATTEGSTLDEEADVDISKPVSTLPRFTHTSDGEGL
AFVNFSSTQQPTTYVDISHTIPLSVIPKKEWEVLVPFVPSEGEVLGEPSQDIHVIDETHL
EATISPETLRTTTEIAQGTTQEEVPWKEQTAEQPVPAPSSTAETAKEATISLDEQESEGS
AYPIPEDKSVTGSERAHILETTPAGEIEHSMSYPPGAITEHREKMGEMVTRTPSVGTEVS
LSPRPEQKYETESSSSMEFESPLSPFSTRVTQLMEETTIEKREKTSLDYIDLGSGLFEKP
TVTEHSEFSTIKATVPSDITAMFSTVDKSHITSTSMPSSTSTEKPRLIDREPGEETTSDM
VIIGESTSHVLPTTPDEIVAKETETEIDREYFTTSSTSTQPTRPPTVEGKEAFTPQAVST
PEPPLGTKFHSDINVYIIEVRENKTGRMSDLSVIGHPIDSESKEEPCSEETEPEHDLIAE
ILPELIEMAIYPSEEDEEEEEDCANATDVTTTPSVQYINGKHLVTTVPKDQEAAEARRGQ
FESVAPSQKISHSHPFVIAETELTPAVQPDESKESKSLEITWKPETYPETPERFSSGEHD
VFPTVQFHEVEATEGADSVTERSPELDHLIHKNAEESSGNDAIDQESQKVVFSKATEVTL
GEEAEKITSVTYAPSIVPSSVSAYVSEESVTLTENPQPADAFSTIESWVEVTPRHVGELL
GTPSSILMPEGSGEGEEEIKMFTVVADLSQRNTTNTEGTLGTSKMITESLFDVPVTTIYS
VSEQPSAEIVPTKFLSETDTSEWVFSTSLEGKKKKDEEETPGTASTTEKHSPTQRSDQLI
LPSELESSNETTFSDSVSTTRKSTTSLTTSTPSEREMTSFTLFTETNGLDNSGAQVTEHS
SSSQPEVQKGLTTVPSIPVSLFVEQGSGDAAADPETTTVSSFSLNLESDIQTKKEAASTL
SSHVENTFPFEPTGFILSTVMDRQVAEIISQTSKENLISEVSGEPSHGEEIRGFPTDFPL
EEDFSGEFREYLTVSPPITKEETIIMEGSGDTVLMDTKTSPSAVPTSDHANHVPHPEGPN
NTTVSTSASLWEEFTALAEGSGEQLVSVSSSVDQVLPSVMGKVSGIDFPFTGQELGEMGA
TTAADKRLTISPTAEAEDVESPTEKGEVIVGGTISVDFPQTLEPAKLWSSQVNLVRQEIE
NKTASEEKIKEQTSFGSPQSSVAPEQIIFDSQTSSETEPPTTDSVLTTKKTYSDDNEMEE
KVIPLVHMATSDPGTKGLEPYTAVPEATEKSHFFLATASVTESVPSESIVMDSSVKMEES
IKPFPKDVRPTIKESDTDLLFSGLGSGEEVLPTVAIVSVNFTEMEQIISTLHPQTSQVEN
LGTRVSSVVTEDYEGMENVTNEVKPLISKTDSTSESSPATSSSTLTGIFSDTRAGGPTAA
PLSLPTDTEHPQKQTVSWAEELQTSKAQTLTEQVSNETSSTAETKETATSSGFLARTYSL
EMAKGFVTSAPKPSELFYEHSGEGSGELGTVDLVHTSGTTQATRQGSTTFVSNRFLEEHP
EVSSAKAVTDDGFPTVSVVPSPHSERNESSPDPTSTPSNTMLYERSAESATSSFPDSFRG
FEDSTLKPDRRKATENIIIDLDKEDKDLILTITESTILEILPELTSDKNTIIDIDHTKPV
YEDILGMQTDTDPELPAGPHGNNEESSQVQEEYGAAVNHSLIKEKLEGSGDTLLASYTQA
THNESTAPEDRSQLDHMGFIFTTEIPVLSTATELETLLPTAASLPIPSQSATINPEIEEP
KIETKTLDDIFESSTLSDGQAIADQSEIISTLGQLERTQKEYEEKKYVGPSFQPEFSSGA
GETLIDHTPDVSIGTIHLMAHSLTEAPTVVEASNPPGYTDTTLAASAFAKLSSQTPSSPV
TIYSGSGASEHTEDLETSALPGTGVETSQMSSGDSAKEAYANIEATFKPSLEKYFHATEP
PSSSPNTELELSEVESKPESLEEKEASPTELIAEERFEVHQDSKNKTSVQLSGETVKEFL
SIRTPETGTVVTAAGEIKLESASQWPHSTSAPATEGIETGVVPQPSPQTSEKPTVPSSLE
INPETQAALSRGEYSTVTASEQQVSARILDSNNQATVSTAELNTELATPSFSLLETSNES
DFLIGINEESVEGTAVYLPGSDRCKTNPCLNGGTCYPTDTAYVCTCVPGYSGDQCELDFD
ECHSNPCRNGATCVDGFNTFTCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRT
WDAAERECRLQGAHLTSILSHEEQMFVNRVGHDYQWIGLNDKMFEHDFRWTDGSTLQYEN
WRPNQPDSFFSSGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFG
KMKPRYEINSLIRYHCKDGFIQRHLPTIRCLGNGRWAIPKITCMNPSAYQRTYAKKYFKN
SSSAKDNSVNSSKHDHRWIRRWQESRR
Download sequence
Identical sequences G3SR13
ENSLAFP00000002275 XP_003408171.1.64505 ENSLAFP00000002275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]